KEGG   Spinacia oleracea (spinach): 110798492Help
Entry
110798492         CDS       T05137                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00260  Glycine, serine and threonine metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110798492
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110798492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_3
Motif
Other DBs
NCBI-GeneID: 110798492
NCBI-ProteinID: XP_021859361
Position
Unknown
AA seq 368 aa AA seqDB search
MGEVASQNGNTAMVVDMRSDTVTKPTEAMRTAMANAEVDDDVLGYDPTALRLETEMARIM
GKEAGLFVPSGTMGNLISVLVHCEVRGSEVILGDISHIHIYENGGISTLGGVHPRTVKNN
KDGTMDLELIEASIRDPNGELFYPMTRLICIENSHANSGGRCLSLEYTDKVGELAKKHGL
KLHIDGARIFNAATALGVPVDRLVQAADSVSVCLSKSLGAPVGTVIVGSKSFITKAKTLR
KALGGGMRQIGILCAAALVAVQDNVKKLEEDHKNTKLLAEGLNQIAGIKVDMSAVETNIV
FVNVCESSNTTAPKLCKHLEDHGVLVMLENTYRMRMVIHHQITENDVKHTLSCLRQAITG
ASSEHIDK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagttgcatcacaaaatggtaataccgcaatggtggtggacatgcgatcagat
acagtgacgaaaccaacagaagcaatgcgtactgcaatggcaaatgctgaggttgatgac
gacgtgttgggttatgacccaactgctcttcgccttgaaacagagatggcaagaatcatg
ggcaaagaggcagggctttttgttccatcagggactatgggaaatctcattagtgtactt
gtacattgtgaagtcaggggaagtgaagtcattcttggagatatctctcatatccatatt
tatgagaatggtggtatttctacccttggtggggtccatcccagaacggttaagaataac
aaggacggtacaatggatttggagttgattgaagcttccattagagatcctaatggggaa
cttttttatcctatgactagacttatttgcattgaaaactcccatgcaaactctggtggt
cgatgcctttctctagagtacacagacaaagttggagagttggcaaagaagcatggtctc
aagcttcatattgatggggctcgtatcttcaatgctgctacagcacttggggttcctgtt
gatagactggtgcaagcagctgactcagtatcggtatgcctctcaaaatctcttggagca
cctgtgggaactgtgattgttggatcaaagagctttataaccaaggcaaagactttgagg
aaagctttaggtggcgggatgagacagattggtatcttgtgtgctgctgcattggttgca
gtgcaagacaatgtgaaaaagcttgaggaagaccataagaacactaagctattagcagaa
ggattgaaccagatagcagggataaaagttgatatgagtgcagttgagacaaacattgtg
tttgtcaacgtatgtgagagctcgaatacaactgcaccaaaactttgcaagcacttggag
gaccatggtgtattggttatgctagagaacacctacagaatgaggatggttattcaccat
caaatcaccgaaaatgatgtgaagcatactttgtcatgtttgaggcaagcgataactggg
gcatcaagtgaacatattgacaagtga

DBGET integrated database retrieval system