KEGG   Spinacia oleracea (spinach): 110800120Help
Entry
110800120         CDS       T05137                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:soe01003]
    110800120
Enzymes [BR:soe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     110800120
Glycosyltransferases [BR:soe01003]
 Polysaccharide
  Structural polysaccharide
   110800120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 110800120
NCBI-ProteinID: XP_021861108
Position
Unknown
AA seq 482 aa AA seqDB search
MTNSTTKFLLLLLLPTFLLIIFFYSYFFNQNNFNFNPTLNKLLKPPSNPSINISNQLDNN
NHVRLRHNISFFTLLKKKLEKKEKKKKKKKSNLEKLEEGLARARAAIREAARTRNYTLKE
EVTTFIPRGSVYRNPHAFHQSHIEMIKRLKIWTYKEGEQPLVHHGPLSNIYGVEGQFIEE
MEGKTTSNKFMARHPDEAHIFFLPFSVAKTVQFLYRPLVSYNRGPLHRVALDYVNVVAMK
YPYWNASHGADHFMVSCHDWAPDISDADPKLFKNLIRALCNANSSEGFQPMRDVSIPEIK
IPVGKLCPPSLGLRISKRQIFAFFAGGNHGHVRTYLFEHWKEKKDEDIQVYEYLPKNLNY
FQMLGQSKFCLCPSGYEVASPRIVEAIHAECVPVIIKDNYSFPFNDVLDWSEFSIHIPVA
KIPEIKTILKRISFKDYLKLVKGVRSVKWHFTLNRPSKPFDLIHMMLHSIWLRRLDIILP
YQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactaactcaaccacaaaattcttactattactactactccctacttttcttctaata
atcttcttctactcatattttttcaaccaaaacaacttcaacttcaatcctactttgaat
aagcttttgaaaccgccatcgaatccatccataaacattagtaatcaacttgataataat
aatcatgttcgtcttcgccataacatctcattttttaccttgctaaaaaagaagcttgag
aagaaggagaagaagaagaagaagaaaaagagcaatttggagaaacttgaggaagggtta
gctcgagctcgggctgcaatccgagaagcagccagaacccggaattatacgttgaaggaa
gaagttacaacctttattccaagaggttccgtttataggaatccacatgcttttcatcag
agtcacatagagatgataaaaagattaaaaatatggacctataaagaaggggagcaaccc
ttggtacatcatggacctttgagcaacatctatggtgtcgaaggccaattcatcgaagaa
atggagggtaagacgacgagcaataagttcatggctcgtcaccccgatgaggcgcacatc
ttctttcttccttttagcgtagccaagacggtgcaattcctttaccggcccctcgtctcc
tacaaccgtggacctctacatagggtggcgttggactatgtcaatgtggtggctatgaag
tatccttattggaatgcaagtcatggggctgaccatttcatggtatcttgccatgattgg
gcaccagatatatctgatgcagatccaaaattgttcaaaaatcttataagagcactttgt
aatgctaattcatcagaagggtttcaaccgatgagagacgtctccatcccggaaattaaa
atcccagtcggaaagttatgtcctccgagcttagggttgcgaataagtaagcgtcaaata
tttgcatttttcgccggtggtaaccatggtcatgtaaggacatacttatttgagcattgg
aaggaaaagaaggatgaggacattcaagtttacgagtatcttcccaaaaacttaaactac
tttcaaatgttagggcaaagcaagttttgcttgtgccctagtggttacgaagtggcaagt
ccaaggatagttgaagctatccacgctgaatgtgtaccggtgatcatcaaagataattac
tctttcccatttaatgatgttcttgattggagtgagttctcaattcatattccggtggcg
aagatacctgagattaagacaatattgaaaaggatttccttcaaagattatttgaaattg
gttaaaggggtgaggagtgtaaagtggcactttacattgaataggccttctaaaccattt
gatttaattcatatgatgttgcattctatatggttaaggaggcttgatataatattacca
tatcaataa

DBGET integrated database retrieval system