KEGG   Spinacia oleracea (spinach): 110800227Help
Entry
110800227         CDS       T05137                                 

Definition
(RefSeq) serine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00340  Histidine metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    110800227
Enzymes [BR:soe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     110800227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110800227
NCBI-ProteinID: XP_021861246
Position
Unknown
AA seq 497 aa AA seqDB search
MAGCHALSQEIHQDFLAVAHITSNGDTSGEARKHLIDNNGEREIVVRQRRRVHTTDLEIN
EQFGANGEAKKSCDVNGKREIVVTRTDLEIKEQPGAANGNLIGEKEAYMEDVLVKHIETW
MDKTKYHLGYPGNLDFNFDDLGDRLQQFLLNNCGDPFIEGNYGMHTKDFEMAVLDWFASL
WEIEKDQYWGYVTNGGTEGNFHGLLIGREMFPDGILYTSKESHYSVFKAAHMYRMDCIKV
DTLVSGEIDYGDLKTRLLENKDKPAIITLTIGTTVKGGVDNIDLVIKTLKECGIPRNRFY
IHCDGALFGLMLPFINRAPQVTFKKPIDSVTISGHKFVGCPITCGIQIVRKQHINVLAKN
VEYIASRDITIMGSRNGQAPIFLWYALNRKGYNGFRKEVQKCMQNARYLRDRLIEVGVSV
MLNELSNTVVFERPKNEEFIQHWQLSCQGNIAHVVVMPNVTVDKLDMFVDEMVEKRLSQP
PCVAFEIGKENCVCSLH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatgtcatgcattgtctcaggagatccaccaagattttctcgccgttgctcac
atcacgagcaacggcgatacttctggtgaggcgaggaagcacctaattgacaacaatgga
gaaagagagattgttgtaagacaaagacggagagtgcacaccacggaccttgaaatcaac
gaacaattcggggcgaacggtgaggcgaagaagagttgtgacgttaatggaaaaagagag
attgttgtaacgcgaacggaccttgaaatcaaggaacaacccggggcggcgaacggaaac
ttgatcggagaaaaggaggcgtatatggaggatgtgttggtgaaacacatagagacatgg
atggacaaaaccaaataccatctaggatatcccggcaatttggactttaactttgatgat
cttggtgatcgattgcaacaatttttacttaacaattgtggtgatccatttattgaggga
aactatggtatgcacactaaggactttgaaatggctgttttagattggtttgctagtctt
tgggagattgagaaggatcaatattggggttatgttacaaatggaggaacagaaggaaac
tttcatggcctattgattgggagagagatgtttcctgatggaattctgtatacctctaaa
gaatcacactactcggttttcaaagccgcgcatatgtacagaatggactgcattaaggtt
gatacattagtttccggagagattgattatggcgatttaaagactaggcttcttgagaac
aaagataaaccagctatcatcaccctcacgatagggactacggtaaaagggggtgttgat
aacatcgatcttgttataaagacacttaaagagtgcggcatcccacgcaatcggttctat
attcactgtgatggagccttgtttggtcttatgctccctttcataaatcgagcccctcag
gtcacattcaagaagccaatcgacagtgtcacaatttcaggccacaaatttgtgggatgc
ccaataacatgtggaattcaaatagtaagaaaacaacacattaacgttctagctaagaac
gtagaatacatagcttcaagggatattacaatcatgggtagtagaaatggtcaagcacca
atctttttatggtacgctttgaatcgcaaaggttataatggatttcgaaaagaggtacaa
aagtgtatgcaaaatgctcgttacctaagagaccgccttatcgaagttggagttagtgtg
atgcttaatgagcttagcaacaccgttgtctttgaacgtccaaaaaacgaggaatttata
caacattggcaactttcttgtcaagggaatatagctcatgtggttgtgatgcctaatgta
acggtagataagcttgatatgttcgttgatgagatggttgagaagcgtttaagccaacct
ccatgtgtagcttttgagattggtaaagaaaattgtgtttgttctttgcattga

DBGET integrated database retrieval system