KEGG   Spinacia oleracea (spinach): 110800419Help
Entry
110800419         CDS       T05137                                 

Definition
(RefSeq) viridiflorene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110800419
Enzymes [BR:soe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110800419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth Methyltransf_7
Motif
Other DBs
NCBI-GeneID: 110800419
NCBI-ProteinID: XP_021861417
Position
Unknown
AA seq 561 aa AA seqDB search
MATVIPKPLQVGVAPVRRPLAHFPPDIWGDRFDNFTVDDKLKMERYEKESEPLKKEVLLM
LMDNSTDSAKKMRLIDAMERLGFPYFYEKEINNLLDKIFKEFAKENFKLKFDLCDTSSQF
RIFRQHGYNMPCDVFTKFTDGKGKFKETLRSDTKGMLSLYEASHLRVNDENILDEALIFT
TDFLNTIAASSEQARCALKQSLHRGIQRVLVRNFISFYEKDTESRNEKLLQLAKIEFNRL
QLLHCQEMSQIQKWWKSFNFVKRLPHVRQRSVESHFWTVATYYEPRYSFARLMYSKFFLV
LLVLDDTYDAYGTFEELQQLTDAFQGWDLSSAEKFPEEYMKIAYKFVINTLDELAKETTR
RGRPYAGHYGKEQVLYLIRNYQIEALWVKTKYVPTYEEYMVNGRATAAVQVCVTGSLLGM
DEVAEHKQYAQLMKPSMALEACEYIVRLMDDIVTAEAELTRGCRLATSVECYMKDYNKSR
EEVLQIFWKKIEDSWKDLAQEGLMTNSSPNDYDHFSKPVYDRILGYGRVLDAVYKVADGY
TLPEATIKKDVIITYSQPFVI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgtgataccgaaacctcttcaagttggtgtagcgccggtcaggcgacctctc
gctcatttcccaccggatatttggggtgaccgcttcgataactttacggttgatgataag
ttgaagatggaaagatatgaaaaagaaagtgaaccattgaagaaggaagtgttgttgatg
ttaatggataattctaccgattcagcaaagaagatgagattaattgatgcaatggaacgt
ctagggttcccctatttttatgaaaaagaaatcaacaatttattggacaagattttcaaa
gaatttgccaaagaaaatttcaaactgaaatttgatttatgtgatacttcatcacagttt
cgcatattcagacaacatggctacaacatgccttgtgatgtattcaccaagttcaccgat
ggaaaaggaaagttcaaagaaacactacgtagtgatacaaagggcatgttgagcttgtat
gaagcttcccatttaagggtaaatgacgaaaatatcctcgacgaagcccttattttcacc
actgatttccttaacaccattgctgcatcatcggagcaagcacggtgcgcgctgaaacag
tcgttgcatcgcggtattcaaagggtactcgttcgtaatttcatctcattttatgagaaa
gatactgaatctcgaaatgagaagctcctacaacttgcaaagattgaattcaacaggttg
cagttgttgcattgccaagaaatgagccaaattcaaaagtggtggaaaagctttaatttc
gtgaaaaggcttcctcatgttaggcaaagaagcgtggaatcgcatttctggaccgtagca
acctactatgaacctcgttactcttttgctagactaatgtattccaagtttttcctggtt
ttacttgttttagatgatacatatgatgcttatggaacgtttgaggaactccaacaactc
accgacgcatttcaagggtgggatttgagttcagcagagaagtttcctgaagaatatatg
aaaattgcatacaaatttgtcattaatactttagacgagcttgccaaggaaacgaccaga
agaggaagaccgtatgcgggtcattatggaaaagaacaagtgctatatttgataagaaac
tatcaaatcgaagcactgtgggttaaaacaaagtatgtgccaacatatgaggaatacatg
gtgaatggaagagcaacagctgctgtacaagtatgtgttacagggtctttgttgggaatg
gatgaagttgcagaacataaacaatatgcacagttaatgaaaccctccatggctctcgaa
gcttgcgagtacattgtccgactcatggacgacattgttactgctgaggcggagctaact
agaggatgtcgtctggccacaagtgtagagtgctacatgaaggattataataaaagcaga
gaagaagtgttgcaaatattctggaaaaagatagaagactcgtggaaggatttagcccaa
gaggggttgatgaccaactcaagccctaatgactatgatcacttctccaaacctgtttat
gatcggatccttggctatggacgtgttctagatgccgtatataaggttgcggatggctat
acattacctgaagccacaattaagaaagatgttatcataacctattctcaaccctttgtc
atttga

DBGET integrated database retrieval system