KEGG   Spinacia oleracea (spinach): 110801598Help
Entry
110801598         CDS       T05137                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:soe01001]
    110801598
Enzymes [BR:soe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110801598
Protein kinases [BR:soe01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110801598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc SKG6 EphA2_TM ABC1 Kinase-like FliH
Motif
Other DBs
NCBI-GeneID: 110801598
NCBI-ProteinID: XP_021862644
Position
Unknown
AA seq 692 aa AA seqDB search
MNFFQLHVFFSQIIWSITFLVIFFFPFCLSSDLQWYNSCGDYFGCGSVEHVGFPFWGGST
RPKKCGYPDLELGCVNNVTTTIQIKGMKYHVLDINQSLQTLRLAREDFLQGICMQKFINT
TLDFELFDYAPGSKNLTVLYGCPPPYTSNPGQFTCKINGSNDTDGYPVEGVIGPSGCSAS
VVVPVLESSYAQIGHLSLSQIIGKGFEAIYKVEDEELCGECEASNGRCAFDLSKDETSCL
CPDGSVRDTSCNYSTSSATSGNSSTKKIVIGVSVVGGTLLVAALLCCSIFAVRRRKQSLA
QAQSKGLGPSYPSTGLPSSNEFRSSQGYTTSPSTYLSQSLPSYPSSKSDFENSADVLGVK
IFSYNELEEATQQFHESQELGDGGFGTVYYGKLNDGQLVAVKRLYENSCRHMGQFLNEIN
ILARLRHKNLVTLYGCTSRKSRELLLVYEYIPNGTVADHLHGKLRSNVLPWFTRLNIAVE
TAEALSFLHENDVIHRDVKTTNILLENSFRVKVADFGLSRLFPNNVTHVSTAPQGTPGYV
DPEYYQCYQLTEKSDVYSFGVVLAELLSSKVAVDITRHRHDINLANMAVDRIQKHAFDEL
IDPELGFEKDCLAQKMVKLVAEVAFQCLQQEKDARPSMKEVLESLKGIKREMENTQKQVV
VDIHESDDDIGLLKNVPPPLSPETEVSNKSIR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctttcagttgcatgtgtttttctcacaaataatatggtccataacattcttg
gttattttcttttttccattttgtttaagcagtgatctacaatggtataatagctgcggg
gattacttcggttgtggcagtgttgaacatgttggctttcccttctggggaggcagcact
aggccgaagaaatgtgggtatccagacttagagctgggttgtgtgaacaatgtcaccacc
acaatacaaattaagggcatgaagtatcatgtcttggacatcaatcagagtcttcagact
ctcaggcttgcaagggaggattttctgcaaggaatttgcatgcagaaatttataaataca
actcttgatttcgagctatttgattatgctcctggatccaagaatctcacagttctatac
gggtgccctcctccttatacatctaatcctggtcaatttacatgcaagatcaatggcagt
aatgatactgatggttatccggtagagggagtgattggtccaagtgggtgtagtgctagt
gttgtggttccagttcttgaatcttcatatgcacaaataggacacttgagtcttagtcaa
attattgggaaagggtttgaagcaatatataaggtggaggatgaagaattatgtggtgaa
tgtgaagcatcaaacggcagatgtgcatttgatcttagtaaggatgagacttcctgcctt
tgcccagatggaagtgttagagatacatcatgcaactactcaacatcttcagcgacatca
ggtaattcttccaccaagaaaattgtaataggggtatctgttgttggaggcacacttcta
gtagctgcccttctatgttgttctatctttgctgtacgaaggagaaagcaatcccttgcc
caagctcaatccaaaggtcttggtcccagctatccaagcactggccttccttcaagcaat
gaatttcggtccagccaaggctatacaactagtccttcaacttacctgtctcagagcctt
ccctcttatccttcctcaaagtctgattttgaaaattctgctgacgttcttggtgtgaag
atcttcagctataatgagctcgaagaagccacccaacaatttcacgagtctcaggagctt
ggagatggtggctttggtaccgtctattatggtaaactcaacgatggacaattagttgca
gtgaaacgcttatatgagaatagttgtaggcatatgggacagttcctgaacgaaatcaat
attcttgctcgcttaaggcacaaaaacctggtcaccctttacggatgcacctcgaggaaa
agcagagagctcctcctagtttatgagtacatccccaacggaacagttgcggatcatctt
catggaaaattacggtctaatgtactcccttggttcacacgactcaacatcgctgttgag
acagctgaggccctgtcttttctccatgaaaatgatgttatacaccgtgatgtgaaaact
acaaacattctcttggagaatagcttcagagtgaaggtggctgatttcggtttatctaga
ctatttccaaataatgtgacccatgtgtccacagcaccacagggaacccctggttatgtt
gatcctgagtattaccagtgctatcagctcacagagaagagtgatgtttacagctttgga
gttgttcttgcagagctgttatcatcaaaagtcgcagtagatatcacacggcataggcat
gatatcaatttggctaatatggctgttgacagaatccagaagcacgcgtttgatgagcta
attgatccagaacttgggtttgaaaaggactgtcttgcacagaagatggtgaaactagta
gcagaagtggcttttcagtgtttgcagcaagagaaagacgcgaggccttcaatgaaagaa
gtgcttgaatcattgaaaggaataaagagagaaatggagaacacgcaaaaacaagtagta
gttgatatccatgaaagcgatgatgatatagggcttttgaagaatgtacctcctcctctt
tcacccgagacagaggtgagtaacaaaagcatcagataa

DBGET integrated database retrieval system