KEGG   Spinacia oleracea (spinach): 110803110Help
Entry
110803110         CDS       T05137                                 

Definition
(RefSeq) arginase 1, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00220  Arginine biosynthesis
soe00330  Arginine and proline metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110803110
   00330 Arginine and proline metabolism
    110803110
Enzymes [BR:soe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     110803110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 110803110
NCBI-ProteinID: XP_021864267
Position
Unknown
AA seq 338 aa AA seqDB search
MQKIARRGIHHMQTLNAAKIPADLIERGQNRVIDASLTLIRERAKLKGELVRALGGAKAS
SSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNATTEGGKELNDPRVLTDVGDVPVQE
IRDCGVDDDRLMKIISDSVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPIDILHL
DAHPDIYHEFEGNKYSHASSFARIMEGGYARRLLQVGIRSINKEGREQGKKFGVEQYEMR
TFSRDRDYLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQA
DIVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKMSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagattgcgaggagggggattcatcacatgcaaactctgaatgcagcaaagatt
cctgccgatttgattgaaagaggccaaaatcgagtaatagatgcctcccttactctcatt
cgtgagagggccaagctcaagggggagcttgtgcgggccttaggaggtgccaaagcctca
tcttcactccttggagtgcctctggggcataattcatcatttcttcaggggcctgctttt
gcccctccgcgtattagagaggcaatttggtgtggaagcacaaatgccacaactgaagga
ggcaaagaactaaatgaccctcgagttctaacagatgttggagatgttcctgttcaagag
atcagggattgtggagtagatgatgatagattgatgaaaattatcagtgactcagtcaaa
ctagttatggaagaagaacctttacgtcctttagtgttaggcggtgaccattcaatatct
tacccggtcgtaagagctgtatctgaaaagcttggaggacctatagatattctacatctt
gatgctcatccagatatttatcacgaattcgaagggaacaagtattcacatgcatcttcc
tttgcccgtataatggagggtggctatgcacggaggctgttgcaggttggtataagatct
ataaataaagaaggtcgggagcaaggaaagaaatttggagttgagcaatatgaaatgcga
acattttcaagagatcgcgattacttggaaaatttgaaactgggcgagggagtgaagggt
gtctacatatcaatcgacgtggactgtcttgatccggcatttgcgcctggcgtatctcac
attgagcctggaggtctttcttttcgtgatgttctcaatattctgcataatcttcaagct
gatatcgtggctgcagacgttgttgaattcaatccacagcgggacactgttgatggtatg
acagcaatggttgcagccaaattggtgagagaactaacagcaaaaatgtcaaagtaa

DBGET integrated database retrieval system