KEGG   Spinacia oleracea (spinach): 110805004Help
Entry
110805004         CDS       T05137                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe03040  Spliceosome
soe04141  Protein processing in endoplasmic reticulum
soe04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:soe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110805004
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110805004
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110805004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:soe01009]
    110805004
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:soe03041]
    110805004
   03009 Ribosome biogenesis [BR:soe03009]
    110805004
   03110 Chaperones and folding catalysts [BR:soe03110]
    110805004
   04131 Membrane trafficking [BR:soe04131]
    110805004
   03051 Proteasome [BR:soe03051]
    110805004
   03029 Mitochondrial biogenesis [BR:soe03029]
    110805004
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:soe04147]
    110805004
Protein phosphatases and associated proteins [BR:soe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110805004
Spliceosome [BR:soe03041]
 Complex B
  Other components
   Prp19 complex
    110805004
 Complex C
   Prp19-CDC5 complex
    110805004
Ribosome biogenesis [BR:soe03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110805004
Chaperones and folding catalysts [BR:soe03110]
 Heat shock proteins
  HSP70 / DNAK
   110805004
Membrane trafficking [BR:soe04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110805004
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110805004
Proteasome [BR:soe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110805004
Mitochondrial biogenesis [BR:soe03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110805004
Exosome [BR:soe04147]
 Exosomal proteins
  Proteins found in most exosomes
   110805004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 110805004
NCBI-ProteinID: XP_021866290
Position
Unknown
AA seq 650 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKHWPFKVIAGPGDKPMIVVSYKGEDKEFSA
EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSQGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKK
KVEAKNALENYVYNMRNTVKDEKIGSKLAEDEKKKIEDSIEQTIQWLDSNQLAEADEFED
KMKELEGLCNPIIAKMYQGAGPDMRGPGAMDDDGPSAGASGPGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaaaggcgaaggtccggctatcggaatcgatctgggcacgacttactcgtgc
gtcggagtatggcaacacgaccgtgttgagatcattgctaatgatcagggtaatagaacg
acaccgtcttatgttgcgttcactgattctgaacggttgattggtgatgctgccaaaaat
caggtcgccatgaaccccaccaacaccgtatttgatgcaaagaggttgattgggaggaga
ttcagcgatgcttcggttcaaagtgacatgaagcattggcctttcaaggtcattgctggt
cctggtgacaagcctatgattgtcgtgtcatacaagggcgaagacaaggagttttctgca
gaagagatctcatcaatggttctcatcaagatgaaagagattgcagaagctttccttggt
tccactgtaaagaatgctgttgttacagtccccgcctacttcaacgactctcagcgtcag
gccaccaaggacgccggtgtcatttctggcctgaatgttatgcgtatcatcaacgagcca
actgctgctgccatcgcatacggtcttgacaaaaaggccactagtgttggtgaaaagaat
gtgttgatctttgatcttggtggtggaacctttgatgtgtcacttctcaccattgaagag
ggtatctttgaagtgaagtccactgctggtgacacccatctaggtggtgaggatttcgat
aatagaatggtgaatcactttgttcaggagtttaagaggaagaacaagaaggatattagc
ggaaaccccagagctcttaggaggttaagaactgcttgtgagagggcaaagaggacactt
tcctccaccgctcaaactacgattgagatcgattctctctttgagggtattgatttctac
tcgaccataactcgggctcgttttgaggagttgaacatggatttgttcagaaagtgtatg
gaaccagttgagaagtgtttgagagatgctaagatggacaagagcaatgttcatgatgtt
gttcttgttggtggttccactaggattcccaaagtacagcaactgttgcaggatttcttt
aatggcaaggagctttgcaagagcatcaacccagatgaggctgttgcttatggtgctgct
gttcaggctgcaattttgagtggtgaaggcaatgagaaggtccaggatcttctgctcttg
gatgttacccctctgtctcaaggtctagagacagctggtggtgtcatgacagtgttgatt
cccaggaacacaaccatcccaaccaagaaggaacaggtgttctcaacgtattccgacaat
caaccaggtgtattgattcaagtttatgaaggtgaaagagcaagaacaagagataacaac
ttgttgggtaaattcgagctttccggcatcccacctgctcctcgcggtgtacctcagatc
accgtctgctttgacatcgatgctaatggtatcttgaacgtgtctgccgaggataaaacc
acagggcagaagaacaagatcactattacaaatgacaagggaagattatcaaaggaagag
attgagaagatggtacaagaggccgagaagtacaaggccgatgatgaggagcacaagaag
aaggtggaggccaaaaatgctttagagaactatgtgtacaacatgaggaatacagtaaag
gatgagaagataggatctaagcttgcagaagatgaaaagaagaagattgaagatagtatt
gagcaaactatccagtggttggatagtaatcagctagctgaggctgatgaatttgaagac
aagatgaaagagcttgagggtctctgcaaccccattatagctaagatgtaccagggtgct
ggccctgatatgagaggtcctggtgcaatggatgatgatggtccctcagctggtgcaagt
ggccctggccccaagattgaagaagttgactaa

DBGET integrated database retrieval system