KEGG   Spinacia oleracea (spinach): 110805026Help
Entry
110805026         CDS       T05137                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00620  Pyruvate metabolism
soe00630  Glyoxylate and dicarboxylate metabolism
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
soe01200  Carbon metabolism
Module
soe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110805026
   00630 Glyoxylate and dicarboxylate metabolism
    110805026
Enzymes [BR:soe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     110805026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI PI3K_P85_iSH2
Motif
Other DBs
NCBI-GeneID: 110805026
NCBI-ProteinID: XP_021866315
Position
Unknown
AA seq 570 aa AA seqDB search
MDLGTSYQYPVAPGPETDGYEVPQGVDVRGRYDHEFAKILSKDALQFVAELQREFKSHVK
YAMECRKEAKAKAKYNSGALPGFDPTTKKIREGDWCCAAPPPAVADRRVEITGPVERKMI
INALNSGAKVFMADFEDALSPSWENLMKGQVNLRDAVNGTISFHEKARNKDYKLNDQIAK
LFVRPRGWHLPEAHILIDGEPATGCLVDFGLYFYHNFANFREKQGDGFGPFFYLPKIEHS
REAKIWNNVFEKAEKIAGIENGSIRATVLIETLPAVFQMNEILYELRDHSAGLNCGRWDY
IFSYIKTFQSHPDRLVPDRVQVGMSQHFMRSYSDLLIYTCHRRGVHAMGGMAAQIPIRDN
PQANEKAMELVKMDKLREVKAGHDGTWAAHPGLIPPILEAFNPNMGNAPNQIWSITRPEA
SSISEEDLLQLPRGVRTMEGLRLNTRVGIQYLAAWLTGSGAVPLYNLMEDAATAEISRAQ
NWQWLKFRAELDGDGLGVKVTPELFARVVEEEMDRIQKEVGSDKFKSENYKEACTIFTRQ
CTATELDDFLTLDAYNHIVIQHPKPGMPRL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggatttgggaacttcatatcaatatccagttgccccgggaccggaaaccgacggctat
gaggtgcctcaaggggtggacgtaaggggtagatacgatcacgagtttgctaaaatccta
tctaaagatgcgttgcaatttgttgctgaattacaaagggagtttaagagccatgttaag
tatgctatggagtgtaggaaggaggctaaggctaaggctaagtataatagtggggcgttg
ccggggttcgatcccaccactaagaagattagggaaggggattggtgttgtgctgcacca
ccgcctgcggttgctgatcggagagtcgagattactggtccggttgagaggaagatgatc
attaatgctcttaattctggggctaaagtattcatggctgattttgaagatgcattatca
ccaagctgggaaaacttaatgaaaggacaagtgaacttaagagatgctgtgaatgggaca
attagtttccatgaaaaggctaggaataaggactacaaactaaatgaccaaattgcaaag
ctctttgtccgccctcgcggttggcacctgcctgaagcccatattcttattgatggcgag
cctgccaccggctgcctagtggattttggcctctacttctaccataactttgccaacttc
agggagaaacagggtgatggctttggccctttcttctatctccctaagatagaacactca
agggaagcaaagatatggaacaatgtgtttgagaaagcagagaagatagcagggatagag
aacggaagtattagggccacggttctcatagagacacttcctgcagtattccaaatgaat
gagatattgtatgagctgagagaccactctgcagggctcaactgtgggaggtgggattat
atcttcagttatatcaagactttccagtctcaccctgaccgcctcgtgcctgaccgtgtt
caggttgggatgtcccaacatttcatgagaagttactctgatcttctcatctacacttgc
cacaggcgcggtgtccacgccatgggaggcatggcggcgcagattccaataagggacaac
ccacaggcgaatgagaaggctatggaactagtaaagatggacaaactgagagaagtaaaa
gcaggccatgatggtacatgggctgcacatccaggcctaatcccaccaatcttagaagcc
ttcaaccccaacatgggtaatgcacctaaccaaatctggtccataacccggcctgaagcc
tcttccatatcagaggaggatctgttgcagctaccccggggagtacgcaccatggaaggg
ctccgtctcaacacccgtgttggaatccaatacctagcagcctggcttacaggatcaggt
gcagttcccctatacaacttaatggaagatgctgctactgctgagataagcagggctcag
aactggcagtggcttaagttcagggctgagttagacggcgatgggcttggggttaaggtc
actccagaactatttgcacgtgtggtggaggaagaaatggacaggattcagaaagaggtt
ggaagtgacaagtttaagagtgaaaactataaggaagcttgcaccatctttacaagacag
tgtactgctactgagttggatgattttctgactcttgatgcttataaccacattgttatc
caacacccaaagcccgggatgccgaggctttaa

DBGET integrated database retrieval system