KEGG   Spinacia oleracea (spinach): 110805117Help
Entry
110805117         CDS       T05137                                 

Definition
(RefSeq) wall-associated receptor kinase-like 8
Organism
soe  Spinacia oleracea (spinach)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF EGF_3 EGF hEGF Pkinase_fungal FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 110805117
NCBI-ProteinID: XP_021866430
Position
Unknown
AA seq 778 aa AA seqDB search
MLKGGWCLGFLCYHKVLLNGKFGQLWPILTLLACLLIIGGSSAAATNAFSQIALPNCPEK
CGNITVPYPFGLGDECRYATPLQDGKYFNLTCNTSVDPPILELGNKLDPVAVEKINLKGE
LLIHYPISYRCYQSNSSVPSSEYRAWISSKKFPVSTTQNIIGAIGCDTFVTLNGTMNNKR
EFRSGCMTVCAALEDVDTRICSGIGCCLISVIPNGVTHLDLVFKSLSDQKLVRDFNPCSV
AFVLAKDHAPNNVLPYSIKQILTQDHTNYRNLKFPVVFDWSIGNVNCETAQAAGDCLCKG
NSKCHDNPHQEGYRCQCIPGFQGNPYLHDCQDIDECATGNLNSCKEPALCINTRGSYNCK
CPRGYSGKGTMNNPCIPYLNGAHPDRYKLVVGLSVIMGSILIFLGGWWCYSFSKKRKVVK
QKAKYFEKNGGLLLKQQMSPDDGVVERTKVFTINELEKATDHFNENRILGRGGHGTVYKG
MLGEGKIVAVKKSKMLKESHIGVFINEVAILSQINHRNIVKLLGCCLETEVPLLVYEFIP
NGTLFHHIHHPSEEFLITWRMRLQIASDSAGALAYLHSSSSIPIFHRDIKSSNILLDDKY
RAKLSDFGTSKSVATDQTHVTTEVMGTFGYLDPGYFQSSQFTEKSDVYSFGVVLVELLTG
QKAIRSIFEEDRSLTSWFLSHMEDSRLLDIIDSHILRKDLKGEFFTIANLAKRCLHSDGK
KRPTMKVVLLEIETVLSLHLIVGTPEGLYYHDSSSLRSSYLDYGPSSSSADTSLLFSH
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaggggggtggtgtttggggtttttgtgctatcacaaagtattgctaaatggt
aagtttggtcaactatggccaatactaactttactggcctgtctactgatcatcggggga
tcatcagcagcagccacgaatgctttttcgcagattgcccttccgaactgccctgaaaaa
tgtggtaacattacggtcccttatccctttggtttaggggatgaatgtcgttatgccact
cctttgcaagatggtaaatacttcaacctcacttgtaacactagtgtcgatcccccgatt
ctagaattggggaataagttggacccagtagcagtagaaaaaattaatttgaagggtgaa
ctcttgatacattaccccatttcatatcgttgttatcagtctaattccagtgtcccgtct
tctgaatatcgggcctggataagttcgaaaaaatttccggtctcaacaacccaaaacatt
atcggtgccattgggtgtgatacatttgtgactctgaatggtacaatgaacaacaagaga
gagtttcgttctgggtgtatgacagtctgtgctgcacttgaagatgttgatactagaata
tgctctggcattggctgttgcctgatttccgttattccaaatggagtgacccatctcgat
ttagtattcaaaagtcttagtgatcagaagttggtgcgtgacttcaacccgtgcagtgtt
gcgtttgtattagcaaaggatcatgctccaaacaatgttctaccttactctattaaacag
attctaacccaagaccatacgaattaccggaatttgaagtttccagttgtcttcgattgg
tctattggaaacgtaaattgtgaaacagcacaagctgcaggggactgcttgtgcaaagga
aacagcaaatgtcatgacaacccacaccaggaaggttaccgctgccaatgcatcccaggg
ttccagggtaacccttaccttcatgactgccaagatattgatgaatgtgcgactggaaac
cttaactcatgtaaggagccagcactctgtatcaacactcgaggaagttataattgcaaa
tgcccacgaggatacagtggcaaagggactatgaacaatccttgtattccttatctgaac
ggtgcacatcctgaccgttacaagttagttgtaggactgagtgtaatcatgggatcaata
cttatttttcttggtggatggtggtgttattcatttagcaagaaaaggaaagttgtcaaa
caaaaagctaaatatttcgagaaaaatggtggtttgttgctgaagcaacaaatgtcccct
gatgatggagttgtagagagaacgaaagttttcacaatcaatgagttagagaaagccact
gaccacttcaatgaaaacagaatacttgggcgaggaggccatggaactgtctataaaggg
atgcttggtgaaggaaaaatcgttgctgtaaagaagtcgaaaatgctgaaagaaagccat
attggagtcttcataaatgaagtggcaatcttgtctcaaattaatcacagaaatattgtc
aagttactgggatgttgtttggagacggaagttccattattggtttatgaatttatcccg
aatggaactctttttcatcatattcatcatccaagcgaagagttcttaatcacatggaga
atgcggttacaaattgcatctgattcagccggagcacttgcatatctacattcttcgtct
tctattcctatatttcatagagacatcaaatcttcaaacatacttttggatgacaagtat
agggctaagttatcagattttgggacatcaaaatctgttgctactgatcaaacccatgta
actactgaagttatgggaacctttggttatttggatccagggtacttccagtctagtcaa
ttcactgaaaagagtgatgtttatagttttggtgtggtccttgtagagcttttaacagga
caaaaggcaatacgttctatttttgaagaggatagaagtttgacatcttggtttctttcc
catatggaagactctaggttgcttgatattattgattctcatattctacgaaaggatttg
aagggagagtttttcactattgctaatctagcaaagcggtgtttacactcggatggaaag
aaaagaccaaccatgaaagttgttctgctagagattgaaacagtattgtcacttcatttg
attgttggaacaccagaaggtttatattatcatgatagttcaagtttgagatcttcttat
ttggattatggcccttcaagttcttctgctgacacttctctgttattcagtcattaa

DBGET integrated database retrieval system