KEGG   Spinacia oleracea (spinach): 110805118Help
Entry
110805118         CDS       T05137                                 

Definition
(RefSeq) wall-associated receptor kinase-like 8
Organism
soe  Spinacia oleracea (spinach)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind PIP49_C
Motif
Other DBs
NCBI-GeneID: 110805118
NCBI-ProteinID: XP_021866431
Position
Unknown
AA seq 744 aa AA seqDB search
MQYKHKTVMISLLLLLLKLQSLLQLTVSSSSFQGAPPIAKPDCQDQCGEVRIPYPFGIGA
SCCHNESYEVICNASFHPPKLFLHRFNLEVMDINWSGRYGGYYTDKETTEQILVVGNIHH
NICNSRKGDVAKTPFNRNIDLRGSPYRFSGWYNVFVVEGCGANVVLKNGYGDIITGCTSI
CTNDTSKKNMTNCNGVGCCQATLLSSPTDGYIEKSTTAGLDYYKIDSYYESLSNTPICNV
TAGLLDIRSLTKFSGKLSSLETFPTVLEWGIASPKSSHNIVCDGGYSGCQCNFPYEGNPY
IPNGCRLIRECQKCNHDCASNQTHGNVKHYYCEKHHHQMFNLGSILGFSISTGSVILLLV
CYWLYRMIKRIKEVKQKAEFFRRNGGLLLQQQISSREGIVGKGRIFGFCELEKATNNFSK
DRILGQGGQGTVFKGMLVDGRIVAIKISKKVDKIQLEQFINEMVILSVVDHRNVVKLLGC
CLETEVPYLVYEFIPNGTLQQLIHDPSEDFHVTWIMRLQIASESACAVAYLHSSCSAPIY
HRDIKTSNILLDDKYRAKVSDFGTSRAITIEQTHVTTCVQGTYGYLDPEYFQSNQFSEKS
DVYSFGVVLAELITGKKAIFPNKYGGWTSLAAEFLFHMENSRLSDILDTHIYEEAKEEEF
IAVANLARQCLNLNGKQRPPMKEVAVVLEQIRSPYASKPRQAECLESECVVMEYDCPFST
DSSLLENSSNTSFYTEALPLLASS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacaaacataaaacagtgatgatatccctgttgttactgcttctgaagctgcaa
tcattactgcagctaactgtatcgtcttcctcctttcagggagctccgcctattgcaaag
cctgattgccaagatcagtgtggtgaggtcaggattccatatccttttggaattggtgcc
agttgttgccataatgaatcctatgaggtcatttgcaatgcttcttttcatcccccaaaa
ttattcttgcatcgtttcaatcttgaggttatggacattaattggagtggaaggtacgga
ggatactacacggacaaggagacaactgagcaaatactagtagtggggaacatccatcat
aatatctgcaacagtcgtaagggtgatgttgctaagactccatttaatcggaacattgac
ctccgaggtagtccatatcgattttcaggatggtacaatgtttttgtagtggagggctgt
ggcgccaacgttgtgttgaagaatggctacggagatattattactggatgtacttcaata
tgtaccaatgatacttctaagaagaacatgaccaattgtaatggggttggatgctgccaa
gctaccctcttgtcatctccaacagacggctatatagaaaaaagtacaacagctggcctt
gattactacaagatagattcttattacgaatcactatccaataccccaatttgcaatgtg
actgcaggcttgcttgacatacgctccttgaccaagttctctggaaaattgtcaagtttg
gaaacattcccaacggtacttgaatggggtattgcaagcccaaaatcttctcacaacatc
gtctgtgacggcggttacagcggttgtcagtgtaacttcccttacgaaggaaacccctat
attcccaatggatgccgattgatcagagaatgtcagaagtgcaatcacgattgtgcttcc
aatcaaacacatggcaatgtgaaacattattattgtgagaagcatcaccatcagatgttt
aacctgggttccattcttggattcagcataagcacaggatcagtgatactactcctagtt
tgctattggctttatagaatgataaagaggataaaggaggttaagcagaaagctgaattc
tttaggagaaatggtggtttactgttgcagcagcaaatttcttctagagagggaattgtc
ggtaagggtagaattttcggtttttgtgagttagagaaagccacaaacaattttagcaaa
gacaggatacttggccaaggaggacaaggtacagtttttaaagggatgttagtggatgga
aggattgtagccattaagatatctaagaaggtagacaagatccagttggagcaatttata
aatgaaatggttattctttctgtagtcgatcaccggaatgttgtcaaattactgggctgt
tgtttagagacagaagtcccgtaccttgtctatgagttcattccaaatggaacactccaa
cagcttattcatgacccaagtgaagattttcatgttacttggataatgcggttacaaatt
gcttcagaatcagcatgtgctgtggcatacctacattcatcctgttctgctccaatatat
catagagacatcaagacatccaatatacttttggatgacaaatacagggcaaaggtttct
gacttcggaacctcaagggccattaccatagagcagactcacgtgactacttgtgttcaa
ggcacatatggttatttggaccctgagtacttccaatcaaaccaattctctgagaaaagt
gatgtttatagctttggagtagtccttgctgaactcataacaggcaagaaagcaattttc
cccaacaaatatggtggctggacaagcttggctgctgagttcctctttcacatggaaaat
tcccgtctgtctgatattttggacactcacatttatgaagaagccaaggaagaggagttt
attgctgtggctaacctagctaggcaatgcttgaatttgaacgggaaacaacgtcctcca
atgaaagaagttgcagtggtgcttgagcaaatcaggtcaccctatgcgtccaagccaaga
caagcagaatgtctggagagtgagtgtgttgtcatggagtatgactgtcctttcagtaca
gactcatccttgctggaaaatagttctaatacttccttttacactgaagccctaccactt
ctggccagtagctga

DBGET integrated database retrieval system