KEGG   Spinacia oleracea (spinach): 110805562Help
Entry
110805562         CDS       T05137                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
soe  Spinacia oleracea (spinach)
Brite
KEGG Orthology (KO) [BR:soe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110805562
Enzymes [BR:soe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     110805562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 NAD_binding_7 Shikimate_DH EF-hand_10 DUF1002 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 110805562
NCBI-ProteinID: XP_021866873
Position
Unknown
AA seq 584 aa AA seqDB search
MTFYEKASRAFYNNPSLSKLLVVVTVSGSAGGGLLAYSDSKPQHVENAVISPEGENKKKK
VVVLGTGWAGTSFLKNLKNPSYDVHVISPRNYFAFTPLLPSVTVGTVEARSICEPIRKMV
KKKDVSVSYWEAECLGIDPVNKKVNCRSTQNADLNGKADFSVDYDYLVIAMGARSNTFNT
PGVEENAHFLKEVEDAQKIRQSIIDCFEKAALPTLSDEEKKRILHFVVVGGGPTGVEFAA
ELHDFVREDLVKLYPKVKDLVKITLLEATDHILNMFDKRITAFAEDKFHRDGINLQTGSM
VVKVTDKEISTKALKNGGEVSSMPYGMLVWSTGIGARPVIMDFMKQLNQGKRRALGTDEW
LRVEGTGEIYALGDCATIVQRKVMEDIAEIFKKADKDNSGTLTVKEMQELVDDILERYPQ
IELYLKNRKMKSIVDLMTDAKKDTTKESVELNIEEFRSALSQVDSQMKNLPATAQVAAQQ
GTYLADCFNRMEKCERNPEGPIRIRGEGQHRFKPFRYRHFGQFAPLGGEQAAAELPGDWV
SIGHSTQWLWYSVYASKQVSWRTRALVVGDWSRRFMFGRDSSRI
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacgttctacgaaaaagcttctagagccttctacaataatccttctctttccaagctt
ctcgtcgttgtcaccgtcagtggaagtgctggtgggggtcttttggcttattcagattca
aagccacagcatgtagaaaatgcagtcatttcacctgaaggtgaaaacaagaaaaagaag
gtggtggtccttggaactggttgggctggaaccagtttcttgaagaacctgaagaatcct
tcatatgatgttcatgtcataagccctcgtaattactttgcatttacccctttgctacca
agtgtcactgttggtacagttgaagcccgtagtatttgtgaaccaattcgcaaaatggtt
aagaagaaagatgttagtgtaagctactgggaagctgaatgtcttggtatagatcctgta
aacaagaaagtaaattgtcgatcaactcaaaatgctgatttgaacgggaaagctgatttt
tctgtggactatgactaccttgtcatcgctatgggagctcgttctaacacattcaacact
cctggggttgaggagaatgcccattttctgaaggaggtggaggacgctcaaaagatccgt
cagagtattattgattgcttcgagaaggccgccctcccaacacttagtgacgaggagaag
aagagaatacttcattttgttgtcgttggcggtggtccaactggtgttgagtttgctgca
gaacttcatgattttgtcagggaagatttagtgaaattgtatcctaaggttaaagacctt
gtgaagataacactgttggaggcaacagatcatatattgaatatgtttgataaaagaatt
acagcatttgctgaggataagttccacagggatggtatcaatcttcaaactgggtcaatg
gttgtgaaagtcactgacaaagaaatatcaaccaaagcgctcaagaatggcggggaagta
tcctccatgccatatggaatgttggtatggtctaccggtattggagctcgtccagtaata
atggacttcatgaagcaacttaatcaaggaaaaaggcgtgccttgggaactgatgagtgg
cttagagtggaaggaactggtgaaatatatgcgttgggtgattgtgcaaccatagtccag
cgcaaagtcatggaagatattgctgagatattcaagaaggctgacaaagataactctgga
actctgactgtgaaagaaatgcaagaactggtagatgacattctggaaagatacccccaa
atcgaactttacctcaagaacaggaaaatgaagagtattgttgacctgatgaccgatgcc
aaaaaggatacaaccaaggaatccgttgaattgaacattgaagaattcagatcagctctc
tcacaagtggactctcagatgaaaaaccttccagcaaccgcccaggttgctgctcaacaa
ggtacctatctagctgactgtttcaatcgtatggaaaagtgtgaaaggaaccctgaaggc
cctatcagaatcagaggagaaggtcaacatcggtttaaacctttcaggtatcgtcatttt
ggtcaatttgctccactgggaggagaacaagctgcagctgagcttcccggagattgggtg
tccattgggcacagcactcagtggttgtggtactcagtgtatgccagcaaacaagtcagc
tggcgtacaagagctttggtggttggagactggtcgaggcgtttcatgttcggtcgggac
tccagtcgcatttaa

DBGET integrated database retrieval system