KEGG   Solimonas sp. K1W22B-7: D0B54_04385Help
Entry
D0B54_04385       CDS       T05591                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
sok  Solimonas sp. K1W22B-7
Brite
KEGG Orthology (KO) [BR:sok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0B54_04385
Enzymes [BR:sok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     D0B54_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AXQ27959
UniProt: A0A346MXC2
Position
915843..917993
Genome map
AA seq 716 aa AA seqDB search
MKNTGLLAKLRGVLLAASAALLPPVAAQATTIDNSTLANEADGSNWAAWGRTFSEQRFSP
LDQVNKDNVGQLGLAWSLELDDVWNVSSQPVAVDGVIYTAVGYSVVHAIDARSGKLLWKY
DPKVESRKMRYAWGSRGLAFWNGKVYTGVQDGRLFALDAKTGQLVWEVMTTTPGDNRYIT
GAPRIFNGKVIIGHGGADFGHVRGYVTTYDAETGKELWRWYVVPGNPADGFENKAMEEAA
KTWSGDWWKYGAGGTVWNAMTYDPEYNRIYLGTGNGSPWNAQLRNPGGGDSLYLCSVVAL
DADTGEYVWHYQTTPNETWDFNSTMDMISATVEMAGKPRKVLMHAPKNGFFYLLDRENGK
LISAEKIGKVTWAEKVDMATGRPVEVRGSRYEKGPALTWPGSGGTHNWHPMAFSPDTGLV
YIPAREMAGFYDGEGRQPGKWQMTPGDVMGLRGFFDDIPKSAGSTSLLAWNPVTQKEVWR
NPTPGATAGGVIVTHGGLVFQGLADGRFVATDAVSGKELWSYSMGVGTQAPPMTYTVDGK
QYVTILAGWGGAPSLLGSLSAQHGWVGRAYPRRMLTFVLDGKAVLPPSPPPIAKVEPLEA
PEFKIDPALAEKGKHVYSQCVICHGSAAVAGGYAPDLRASPVPLSHEAFKAIVQGGALES
RGMPKFEEFTDEDITALQHFLRERARYKPSAWEQIKQVFGFIWLMIKMKLLAMGWL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataccggcctgctggcgaagctccgcggtgtcctgctggcggccagcgcggca
ctgctgccgccggtggcggcgcaggcgaccaccatcgacaacagcacgctcgccaacgag
gccgacggcagcaactgggccgcctggggccgcaccttcagcgagcaacgcttcagcccg
ctggaccaggtcaacaaggacaacgtcggccagctcggcctggcctggtcgctggagctg
gacgatgtctggaacgtgtcgagccagccggtggccgtggacggcgtgatctacaccgcc
gtgggctacagcgtggtgcatgcgatcgacgcgcgcagcggcaagctgctgtggaagtac
gaccccaaggtggagtcgcgcaagatgcgctacgcctggggcagccgcggtctcgcgttc
tggaacggcaaggtctacaccggcgtgcaggacgggcgactgttcgcgctcgacgccaag
accggccagctggtctgggaggtgatgaccaccacaccgggcgacaaccgctacatcacc
ggcgcgccgcgcatcttcaacggcaaggtcatcatcggccacggcggcgccgacttcggt
cacgtgcgcggctacgtcaccacctacgacgccgagaccggcaaggagctgtggcgctgg
tacgtggtgccgggcaatcccgccgacggcttcgagaacaaggcgatggaagaggccgcc
aagacttggagcggcgactggtggaagtacggcgccggcggcacggtctggaacgccatg
acctacgacccggagtacaaccgcatctatctgggcaccggcaacggctcgccctggaac
gcgcagttgcgcaatcccggcggcggcgacagcctctacctgtgctcggtggtggcgctg
gacgccgacaccggcgagtacgtctggcactaccagaccacgccgaacgagacctgggac
ttcaactccaccatggacatgatctcggccacggtcgagatggcggggaagccgcgcaag
gtgctgatgcacgcgcccaagaacggcttcttctacctgctggaccgcgagaacggcaag
ctgatctcggccgaaaaaatcggcaaggtcacctgggccgagaaggtcgacatggctacc
ggccgcccggtggaagtgcgcggctcgcgttacgagaagggtccggcgctgacctggccc
ggctccggcggcacgcacaactggcacccgatggccttcagccccgacaccggcctggtc
tacatcccggcgcgcgagatggccggcttctacgacggcgaaggccgccagcccggcaag
tggcagatgaccccgggcgacgtcatgggcctgcgcggcttcttcgacgacatccccaag
agcgccggcagcacctcgctgctggcctggaacccggtgacgcagaaagaggtctggcgc
aacccgacgccgggcgccaccgccggcggcgtcatcgtcacgcacggcggcctggtgttc
cagggcctggccgacggccgcttcgtcgccaccgacgccgtcagcggcaaggagctgtgg
agctacagcatgggcgtcggcacgcaggcgccgccgatgacctacacggtggacggcaag
cagtacgtgaccatcctcgccggctggggcggcgcaccctcgctgctgggctcgctcagc
gcgcagcacggctgggtcggccgcgcctacccgcgccgcatgctgaccttcgtgctcgac
ggcaaggcagtgctgccgccgtcgccgccgccgatcgccaaggtcgagccgctggaagcg
ccggagttcaagatcgacccggcgctggccgagaagggcaagcacgtctacagccagtgc
gtgatctgccacggcagcgccgccgtcgccggcggctacgccccggacctgcgcgcctcg
ccggtgccgctgtcgcacgaggccttcaaggccatcgtccagggcggcgcgctggaatcg
cgcggcatgccaaagttcgaggagttcaccgacgaggacatcaccgcgctgcagcacttc
ctgcgcgaacgcgcccgctacaagccctcggcctgggagcagatcaagcaggtcttcggc
ttcatctggctgatgatcaagatgaagctgctggcgatgggatggttgtag

DBGET integrated database retrieval system