KEGG   Solimonas sp. K1W22B-7: D0B54_06995Help
Entry
D0B54_06995       CDS       T05591                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok00450  Selenocompound metabolism
sok00970  Aminoacyl-tRNA biosynthesis
sok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D0B54_06995
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D0B54_06995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sok01007]
    D0B54_06995
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sok03016]
    D0B54_06995
Enzymes [BR:sok01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D0B54_06995
Amino acid related enzymes [BR:sok01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D0B54_06995
Transfer RNA biogenesis [BR:sok03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D0B54_06995
 Prokaryotic type
   Other AARSs
    D0B54_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AXQ28443
UniProt: A0A346MYQ6
Position
complement(1513002..1515050)
Genome map
AA seq 682 aa AA seqDB search
MSRQILVTNALPYANGPIHLGHMVGYIQADIWVRYQRLQGHEVHYVCADDAHGTPIMLAA
EKAGMTPEAFIAGIKTEHERDFREFGVNFDLYHSTHSPENEELAGLIYTRLKQGGAIASR
TIQQLYDPVKEMFLPDRYIKGECPRCGTADQYGDNCENCGAAYAPTDLKNPRSVVSGATP
VMKDSEHYFFELPRFQAFLQDWLAGEVAHSSIRAKLQEWFDGGLRDWDISRDAPYFGFAI
PGAPGKYFYVWLDAPIGYMAAFRALCGQRKLDFDRYWAAGSQAELHHFIGKDIVNFHGLF
WPAMLQGSQHRTPTRLHVNGYLTINGAKMSKSRGTFIRGRTYLNHLNPEYLRYYFAAKLG
DGPDDLDLSLEDFTNRVNSDLVGKYVNIASRCAGFIEKLFGGRLAVAMHDRTLFEDFAGE
AANLAKLYETGDFAGAMREIMLMADDANGEIQKLAPWTLARDEAQRERLHQICTSFINLF
RQLTIYLKPVLPNVAAQVEQFLLAEHPLTWADAHKPLLGTDIRPYAALITRVDPKATEAM
LAEEAASTAPADKKPETAAPAKAAAPAPAATDAAHIGIEDFGKVDLRIARIENAEHVEGA
DKLLKLTLDLGPLGKRQVFAGIKSAYAPEQLVGKLTVMVANLAPRKMKFGMSEGMVLAAS
HGDGKPFLLWPDSGAEPGMRIK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagatcctggtcaccaacgcccttccctacgccaacggcccgatccacctg
ggccacatggtcggctacatccaggccgacatctgggtgcgctaccagcggctgcaggga
cacgaggtgcactacgtctgcgccgacgacgcccatggcacgccgatcatgctggcggcg
gaaaaggccggcatgacgccggaagccttcatcgccggcatcaagaccgagcacgaacgc
gacttccgcgagttcggcgtgaatttcgacctctaccactccacgcactcgcccgagaac
gaggagctggccgggctgatctacacacgcctgaagcagggcggcgccatcgccagccgc
acgatccagcagctctacgacccggtgaaggagatgttcctgccggaccgctacatcaag
ggcgaatgcccgcgctgcggcacggccgaccagtacggcgacaactgcgagaactgcggc
gccgcctacgcccccaccgacctgaagaacccgcgctccgtggtctccggcgccacgccg
gtgatgaaggactccgagcactacttcttcgagttgccgcgcttccaggctttcctgcag
gactggctggcgggcgaggtcgcgcactcctcgatccgcgccaagctgcaggaatggttc
gacggcggcctgcgcgactgggacatttcgcgcgacgcaccctacttcggcttcgccatt
cccggcgcgccgggcaagtatttctacgtctggctggacgcgccgatcggctacatggcc
gcgttccgcgcgctctgcggccagcgcaagctggacttcgaccgctactgggccgccggc
tcgcaggccgagctgcaccatttcatcggcaaggacatcgtcaacttccacggcctgttc
tggccggcgatgctgcagggctcgcagcaccgcacgccgacgcgcctgcacgtcaacggc
tacctcacgatcaacggcgccaagatgtcgaagtcgcgcggcaccttcatccgcgggcgc
acctacctgaaccacctgaacccggaatatctgcgctactacttcgcggccaagctcggc
gacgggccggacgatcttgacctgagcctggaggacttcaccaaccgggtgaacagcgat
ctggtcggcaagtacgtcaacatcgccagccgctgcgccggcttcatcgaaaagctgttc
ggcggccgcctggcggtggccatgcatgaccgcacgctgttcgaggacttcgccggcgag
gccgccaatcttgccaagctctacgagacgggcgacttcgccggcgcgatgcgcgaaatc
atgctgatggccgacgacgccaacggcgagatccagaagctggcaccctggacgctggcc
agggacgaggcgcagcgcgagcgcctgcaccagatctgcaccagcttcatcaacctgttc
cgccagctgacgatctacctcaagcccgtgctgcccaacgtggcggcgcaggtggagcag
ttcctgctggccgagcacccgctgacctgggccgatgcgcacaagcccctgctgggcacc
gacatccgtccctacgccgccctgatcacccgcgtcgatcccaaagccaccgaagccatg
ctcgccgaagaagccgccagcaccgcccccgcggacaagaagccggaaaccgccgctccc
gccaaggccgcagcccctgcgcccgccgccacggatgccgcgcatattggcatcgaggac
ttcggcaaggtggacctgcgcatcgcgcgcatcgagaacgccgagcacgtcgagggcgcc
gacaagctgctgaaactgacgctggacctgggccccctgggcaaacgccaggtcttcgcc
ggcatcaagtcggcctatgcgccggaacagctggtgggcaagctcaccgtcatggtcgcc
aacctggcaccgcgcaagatgaagttcggcatgtccgagggcatggtgctggccgccagc
cacggcgacggcaagcccttcctgctgtggccggacagcggggcggagccggggatgcgg
atcaagtaa

DBGET integrated database retrieval system