KEGG   Solimonas sp. K1W22B-7: D0B54_14680Help
Entry
D0B54_14680       CDS       T05591                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok00010  Glycolysis / Gluconeogenesis
sok00020  Citrate cycle (TCA cycle)
sok00620  Pyruvate metabolism
sok01100  Metabolic pathways
sok01110  Biosynthesis of secondary metabolites
sok01120  Microbial metabolism in diverse environments
sok01130  Biosynthesis of antibiotics
sok01200  Carbon metabolism
Module
sok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D0B54_14680
   00020 Citrate cycle (TCA cycle)
    D0B54_14680
   00620 Pyruvate metabolism
    D0B54_14680
Enzymes [BR:sok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     D0B54_14680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_18 DUF5478 AAA_33
Motif
Other DBs
NCBI-ProteinID: AXQ29844
UniProt: A0A346N2Q7
Position
3273192..3274844
Genome map
AA seq 550 aa AA seqDB search
MTFQADLEKLFGLKNVSYKYNLTKPELFHEAIANDRGRVRRGGPSNEQKAFPTQLGLNGP
LVYYTDPDCTGRRTKDTYAVKWPEIADEIWFKADLNPYDSEKYEALLKRVVAHLNEKQGT
LYVKDLFMGSDADFAVPYRFVGEYATHAMFCHNMFPKDLQGVKDVDARRWTMLNVPSFVC
EPERDGSRAEAAVIIDTRNKICLVAGRADYCGVNKKTIFTVGNYLLPKEGRLSMHCSANV
GKNNDAAILFGLSGTGKTTLSADASRRLIGDDETIWSDNGLCNLEDGCYAKLIDLDKQNE
PVIAQALSKAGTIIENVPPLPGKTMEECHPDELDLFDGSIAENTRFSYPLDANPNVMPNG
QGPHPKTIVLLTADAFGVLPPISILEPKDVMYHFVSGFTARVAGTEVGVTEPQPTFSACF
GGPFMAQKPNVYAKLLAEKMEQHQARCILLNTGWSGGPHGVGKRMSLKVTRALLNAALNG
ELDGVETEVQPTLNLKMPKSCPGVDSNILNPRNTWADKDAYDATATKLRDMFRDNFKKKG
FAAFGIEERI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaggccgatctcgagaagctcttcggactcaaaaacgtcagttacaagtac
aacctgaccaagccggagctgtttcacgaagccatcgccaacgaccgcggccgcgtccgc
cgtggtggtcccagcaatgagcagaaagctttcccgacccagctgggcttgaatggtccg
ctggtctattacaccgacccggactgcaccggccgccgcaccaaggacacctacgcggtg
aaatggccggagatcgccgacgagatctggttcaaggccgacctcaacccctacgattcc
gagaagtacgaggcgctgctcaagcgcgtcgtcgcccatctgaacgagaagcagggcacg
ctgtacgtgaaggacctgttcatgggttccgacgcggacttcgccgtgccttaccgcttc
gtcggcgagtacgccacgcatgcgatgttctgccacaacatgttccccaaggacctgcag
ggcgtgaaggatgtcgacgcccgccgctggaccatgctgaacgtgcccagcttcgtctgc
gagcccgagcgtgacggcagccgcgccgaagccgcggtgatcatcgacacgcgcaacaag
atctgcctggtggccggccgcgccgactactgcggcgtcaacaagaagaccatcttcacg
gtcggcaactacctgctgcccaaggaaggccgcctgtcgatgcactgctcggccaacgtc
ggcaagaacaacgacgcggcgatcctgttcggcctctccggcacgggcaagaccacgctg
tcggccgacgcaagccgccgcctgatcggcgacgacgagacgatctggtccgacaacggc
ctgtgcaacctggaagacggctgctacgccaagctgatcgacctggacaagcagaacgag
ccggtcatcgcccaggcgctgagcaaggccggcaccatcatcgagaacgtgccgccgctg
ccgggcaagacgatggaagagtgccacccggacgagctggacctgttcgacggctcgatc
gccgagaacacccgcttctcctacccgctcgacgccaaccccaacgtcatgcccaacggc
cagggtccgcatccgaagaccatcgtgctgctgaccgccgatgccttcggcgtgctgccg
ccgatctcgatcctggagcccaaggacgtcatgtaccacttcgtctcgggcttcaccgcc
cgcgtcgccggtacggaagtgggcgtgaccgagccgcagccgaccttctcggcctgcttc
ggcggccccttcatggcgcagaagcccaatgtctacgccaagctgctggccgagaagatg
gagcagcaccaggcacgctgcatcctgctgaacaccggctggagcggcggcccgcacggc
gtcggcaagcgcatgtcgctgaaggtgacccgcgccctgctcaatgccgccctcaacggc
gagctggacggcgtcgagaccgaggtccagccgacgctgaacctgaagatgcccaagtcc
tgcccgggcgtggacagcaacatcctgaacccgcgcaacacctgggccgacaaggatgcc
tacgacgccaccgccaccaagctgcgcgacatgttccgcgacaacttcaagaagaagggc
tttgccgccttcggcatcgaagagcgcatctaa

DBGET integrated database retrieval system