KEGG   Solimonas sp. K1W22B-7: D0B54_23770Help
Entry
D0B54_23770       CDS       T05591                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sok  Solimonas sp. K1W22B-7
Pathway
sok00020  Citrate cycle (TCA cycle)
sok00480  Glutathione metabolism
sok01100  Metabolic pathways
sok01110  Biosynthesis of secondary metabolites
sok01120  Microbial metabolism in diverse environments
sok01130  Biosynthesis of antibiotics
sok01200  Carbon metabolism
sok01210  2-Oxocarboxylic acid metabolism
sok01230  Biosynthesis of amino acids
Module
sok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sok_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D0B54_23770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D0B54_23770
Enzymes [BR:sok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     D0B54_23770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AXQ31517
UniProt: A0A346N7I0
Position
complement(5307478..5309709)
Genome map
AA seq 743 aa AA seqDB search
MTQQNQTIIYTLTDEAPLLATASFLPIVRAFTEPAGIQVVTSDISVAARILGEFSDFLAP
EQRVPDNLAELGKLTLLPDTNIIKLPNISASQHQLTSAIKELQSKGYPVPDFPEDPKTDA
ETAIRKRYSKCLGSAVNPVLREGNSDRRAPNAVKEYARKNPHSMGDWSMASRSHVAHMKH
GDFYHGEKSMTLDRPRDVKMELVTRDGRTLLLKPKVSLLEGEVIDSMFMSKKALLAFYEE
QMEDSRKTGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHGHLFDELGVNVNNGLV
NLYDKLENLPSSKREEIIRDMHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVMPESTFARIYQEMINFCKTNGNFDPVTMGTVPNVGLMAQQAE
EYGSHDKTFEVAEGGEARVIDIATGEVLLTQQVEEGDIWRMCQVKDAPIRDWVKLAVIRA
RNSGMPAVFWLDEYRPHENELIKKVKLYLKDHDTSGLDIQIMSQVRAMRYTLERLIRGKD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSIEELGIKTGNKQARILAKALDAATGKLLDNNKNPSPKTGQLDNR
GSQFYLALYWAQELAAQTEDAALATRFAPLAKTLTEKEKTILGELGDVQGRPVDIGGYYL
PDAAKLDAVMRPSKTLNEALAGV
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcagaaccagaccatcatctacaccctgaccgacgaggcgccgctgctggcc
accgcctcgttcctgcccatcgtccgcgcgttcaccgagccggccggcatccaggtcgtc
accagcgacatctccgtggccgcccgcatcctgggcgagttctcggacttcctggcgccg
gaacagcgcgtacccgacaacctcgccgagctgggcaagctcaccctgctgcccgacacc
aacatcatcaagctgcccaacatcagcgcctcccagcaccagctcaccagcgccatcaag
gagctgcagtctaagggctacccggtgccggacttcccggaagaccccaagaccgacgcc
gaaaccgccatccgcaagcgctactccaagtgcctgggcagcgccgtcaatcccgtgctg
cgtgaaggcaactcggaccgccgcgcccccaacgccgtcaaggaatacgctcgcaagaac
ccccacagcatgggcgactggagcatggcctcccgctcccacgtcgcgcacatgaagcac
ggcgacttctaccacggcgaaaagtccatgaccctggaccgcccgcgcgacgtcaagatg
gagctggtcacccgcgacggccgcaccctgctgctcaagcccaaggtctcgctgctcgaa
ggcgaagtgatcgacagcatgttcatgagcaagaaagccctgctggccttctacgaagaa
cagatggaagactcgcgcaagaccggcgtcatgttctcgctgcacgtcaaggcgaccatg
atgaaggtctcgcaccccatcgtcttcggccacgccgtacgcatcttctacaaggacgcc
ttcgccaagcacggccacctgttcgacgagctgggcgtcaacgtcaacaacggcctggtc
aacctctacgacaagctcgagaacctgcccagctccaagcgcgaagagatcatccgcgac
atgcacgcctgccacgagcaccggcccgaactggccatggtggactccgccaagggcatc
tccaatctgcatgcgccgaacgacgtcatcgtagacgcctccatgcccgccatgatccgc
atcggcggcaagatgtggggtgcggacggccgtcccaaggacaccaaggccgtgatgccc
gagagcaccttcgcgcgcatctaccaggagatgatcaacttctgcaaaaccaacgggaac
ttcgaccccgtcaccatgggcaccgtgcccaacgtcggcctcatggcccagcaggccgag
gaatacggctcgcacgacaagaccttcgaggttgccgagggcggcgaagcccgcgtcatc
gacatcgccaccggcgaagtgctgctcacccagcaggttgaagagggcgacatctggcgc
atgtgccaggtcaaggacgccccgatccgcgactgggtcaagctcgccgtcatccgcgcc
cgcaactccggcatgcccgccgtgttctggctcgacgaataccgcccgcacgagaacgag
ctcatcaagaaggtgaagctctacctcaaggaccacgacaccagcgggcttgacatccag
atcatgtcgcaggtgcgcgccatgcgttacacgctcgagcgcctcatccgcggcaaggac
accatctccgtcaccggcaacatcctgcgtgattacctgacggatctgttccccatcatg
gagctgggcaccagcgccaagatgctgtccatcgtcccgctgatggccggtggcggcatg
tacgaaaccggcgccggcggctccgcccccaagcacgtcaagcagctggtggaagaaaac
cacctgcgctgggactcgctcggtgaattcctcgccctggccgtgagcatcgaagagctc
ggcatcaagaccggcaacaagcaggcccgcatcctcgccaaggccctggacgccgccacc
ggcaagctgctcgacaacaacaagaacccctcgcccaagaccggccagctcgacaaccgc
ggcagccagttctacctcgccctctactgggcccaggaactcgcagcacagaccgaagac
gcggccctcgccacccgcttcgcccccctggccaagaccctcaccgagaaagagaagacc
atcctcggagagctcggcgacgtgcagggccgcccggtcgacatcggcggctactacctg
ccggatgccgcgaagctggatgcggtgatgcggccgagcaagacgctgaatgaggcgttg
gcgggggtttga

DBGET integrated database retrieval system