KEGG   Saccharolobus solfataricus 98/2: Ssol_0169Help
Entry
Ssol_0169         CDS       T02126                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIA
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sol  Saccharolobus solfataricus 98/2
Pathway
sol00627  Aminobenzoate degradation
sol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sol00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ssol_0169
Enzymes [BR:sol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     Ssol_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase Hydrolase_3 YhfZ_C QSOX_Trx1
Motif
Other DBs
NCBI-ProteinID: ACX90465
UniProt: D0KUZ4
Position
144382..145176
Genome map
AA seq 264 aa AA seqDB search
MSVLNGYQLIISDVDGVIVREGDPIWENIQALRNIQNNGVKIIFVTNNSGFSRILLSRQL
SYLGLKVTPDMIITSGLAAAIYMKEKLNVKSVFAVGEEGLIEELKNHGFLVFSSAESERI
LPDAVVMGLDRLSTYDKLSLAMRCISKGSKFIVTNMDRLWPAKDGLKLGAGALASSIIYA
LRRDPDFIAGKPNTWIVEIAMRISNVKKLDKILVIGDQIETDIQMGYNIGADTALVLTGI
SNVDDVDRSNVKPKYVVNTLLDLL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttaacggctatcaattaataataagtgatgtagatggggtaatagtaaga
gaaggagatccaatatgggagaatattcaagcgctaaggaatatacaaaataacggagtt
aagatcatatttgtaacaaacaactctggttttagtaggatcttattatctaggcagtta
tcatacttaggccttaaagttaccccagatatgataattacaagtggtttagctgcagca
atttatatgaaagaaaaactcaatgtcaaatcagtattcgcagtaggcgaagagggcctt
attgaagaattgaaaaatcacggttttttagtattctcaagcgcagaatcagagagaatt
ttaccagacgcggtcgtaatgggattagataggttaagtacctatgataaactgtcgtta
gccatgaggtgcataagcaaaggatcgaaatttatagtaacaaatatggacaggctttgg
ccagctaaggatggattaaaattgggtgccggtgcgttagctagttctataatttacgcg
ttaagaagggatccggacttcatagctgggaaacctaatacttggatagtagaaatagcc
atgcggatttctaatgttaagaagttagataagattctagttataggagatcaaatagag
actgatatccagatggggtacaatataggtgccgacactgcattagtcttaactggaata
tcaaacgtagatgatgttgataggagtaatgttaagccgaaatatgtagtaaatacttta
ttagaccttttgtga

DBGET integrated database retrieval system