KEGG   Sulfolobus solfataricus 98/2: Ssol_0408Help
Entry
Ssol_0408         CDS       T02126                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sol  Sulfolobus solfataricus 98/2
Brite
Enzymes [BR:sol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ssol_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 MTS Methyltransf_4 Met_10 Methyltransf_3 DOT1 CMAS
Motif
Other DBs
NCBI-ProteinID: ACX90691
UniProt: D0KNS1
Position
365266..365976
Genome map
AA seq 236 aa AA seqDB search
MSAKDDILRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYVDKPFYITPNVTTTALSL
GMYMLDILNLGETQKVLEIGTGIGYYTALMAEVVGDNNVISLEIDDTIFEYAKNILLPKY
PRIKLIKTDGSLGYDKEAPYDRIIIWAAAPTVPCKLYDQLRENGIMVVPIGSEKAQGLYR
ITKIGYEPKIERLGDVIFMKMRGLFGFYEDDDPNERRIKKIEEKVNRLLSKFMSQS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaaagacgacatattaaggtccataaagaattcaaaattagcaaatgcgttt
ataaaggttaatagggaggattttttgccacaattactgaaaaaatatgcatatgatcct
aattatgtagacaagcccttttacataacgcctaatgtgacgacaactgcattaagttta
ggcatgtatatgctcgatattcttaatttgggagaaactcagaaagttttagagataggt
acgggcataggttattatactgcgttaatggctgaagttgttggcgataataacgttatc
tcattagaaattgatgatacgatatttgaatacgctaaaaatattcttctgccgaaatat
ccgcgaatcaaattaattaagactgatggaagtctaggatatgataaggaggctccttat
gataggatcataatatgggcagctgcgccaacagtcccttgtaaactgtacgatcaactt
agggagaacggtattatggtagtaccgataggtagtgaaaaagcgcaaggtctctataga
attactaaaattggatatgaacctaagatagaaagacttggagatgtaatatttatgaaa
atgagaggattatttggattttatgaggatgacgatccgaatgagaggagaataaagaaa
atagaggagaaggttaatagattactgtcaaaatttatgagccagagctag

DBGET integrated database retrieval system