KEGG   Shewanella oneidensis: SO_2912
Entry
SO_2912           CDS       T00099                                 

Symbol
pflB
Name
(GenBank) pyruvate formate-lyase PflB
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
son  Shewanella oneidensis
Pathway
son00620  Pyruvate metabolism
son00640  Propanoate metabolism
son00650  Butanoate metabolism
son01100  Metabolic pathways
son01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_2912 (pflB)
   00640 Propanoate metabolism
    SO_2912 (pflB)
   00650 Butanoate metabolism
    SO_2912 (pflB)
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SO_2912 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAN55926
UniProt: Q8ED58
Position
3042166..3044448
AA seq 760 aa
MTDKTELFANAWEGFTPGDWKSEVNVRDFIQQNYAPYEGDESFLAGATDATTQLWDKVME
GIKQENRTHAPVDFDTKMVSTITSHDAGYINKDLETIVGLQTDAPLKRAMLPNGGIRMVE
SSCAAYDRVLDEDVKYIYSELRKTHNQGVFDVYTPEIMACRKSGVLTGLPDAYGRGRIIG
DYRRVALYGIDFLMKDKFAQFSSLQAQFEAGEDLSNVIQLREEIAEQHRALGQMKKMAAK
YGFDISRPASNAKEAIQWTYFGYLAAVKSQNGAAMSLGRTSSFLDIYIERDLKNGVITEQ
QAQEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKSSFRFLNT
LYTMGPSPEPNITVLWSEKLPVGFKKYCAKVSIDTSSIQYENDDLMRPDFQSDDYAIACC
VSPMVVGKHMQFFGARANLAKTMLYAINGGVDEKLKIQIAPKADPITDKVLNFDDVMNRL
DGLMDWLATQYVTSLNAIHYMHDKYSYEAALMALHDRDVRRTMACGIAGLSIAADSLSAI
KYAQVKPVRDENGIAVDFEISGDYPKFGNNDPRVDDIACDLVERFMAKIRDRKMYRNAIP
TQSILTITSNVVYGKKTGNTPDGRRSGAPFAPGANPMHGRDEKGAIASLTSVAKLPFAHA
QDGISYTFSIVPNALGKDEDGRRTNLAALMDGYFAHNEGHEGGQHLNVNVMNREMLEDAV
VNPDKYPQLTIRVSGYAVRFNSLTPEQQQDVITRTFTKGL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgaccgacaaaactgaactgtttgccaacgcatgggaaggttttacccctggtgattgg
aaatctgaagtcaatgtacgtgactttattcaacaaaactacgctccctatgaaggtgac
gagtcattcctagccggtgccaccgacgccacaacccagttgtgggataaagtgatggaa
ggcatcaagcaagaaaaccgtacccatgcgccagttgatttcgatactaagatggtttct
accatcacttcccacgacgcgggttatatcaataaagatttagaaactatcgttggttta
caaactgatgcgccgctcaaacgcgctatgttacctaacggtggtattcgtatggtggaa
agctcatgcgccgcctacgatcgcgtgctagatgaagatgttaaatacatttattcagaa
ctgcgtaaaacccacaaccaaggcgtattcgacgtctataccccagaaatcatggcctgc
cgtaaatccggtgtattaaccggtttacccgatgcctatggccgtggccgtatcattggt
gactatcgccgtgtagcactttacggtatcgacttcttaatgaaggacaaattcgctcaa
ttcagctcactgcaagcgcagttcgaagcgggtgaagatttgtctaacgttatccaacta
cgtgaagaaattgctgagcagcaccgtgcattgggccaaatgaagaaaatggccgctaaa
tatggtttcgatatttctcgcccagcatccaatgctaaagaagcaatccagtggacttac
ttcggctacttagccgcagtgaagagccaaaacggcgccgcaatgtctttaggccgtact
tcttcattccttgatatctatatcgaacgcgatctgaaaaacggcgtcatcactgagcaa
caagctcaagaaatgattgaccattttgtaatgaaactgcgtatggtgcgtttcctacgt
actccagaatacgatgagttattctcaggcgatccaatttgggcaactgaatctatcggc
ggtatgggcttagatggccgtacactggtgactaaatcaagcttccgtttcttgaacacg
ctgtacaccatgggcccaagccctgagccaaacatcactgtgctctggtctgaaaaactg
ccagtaggctttaaaaagtactgcgcaaaagtatctatcgacaccagctcaatccagtac
gaaaacgatgacttaatgcgtccagatttccaatctgacgattacgctatcgcttgctgc
gtgagcccaatggttgtgggtaaacacatgcagttcttcggtgcccgtgccaacctcgcc
aaaaccatgttgtacgcgattaacggcggtgtggacgaaaaactgaagatccaaatcgcc
cccaaagcagacccaatcactgacaaagtactgaactttgatgatgtgatgaatcgctta
gacggtttaatggattggttagcaacgcaatatgtcacttctctgaacgctattcactac
atgcacgacaagtactcctatgaagctgcgctaatggcgctgcacgacagagacgtacgt
cgtactatggcttgcggtattgctggactttcaatcgcagccgactcactgtctgctatc
aagtacgctcaagttaaacctgtacgtgatgaaaacggcatcgccgttgactttgagatc
agtggtgactatccaaaatttggtaacaacgacccacgcgttgacgatatcgcctgtgac
ttagttgaacgttttatggcgaaaattcgcgaccgtaaaatgtaccgcaacgcgattcca
actcagtcaattctcaccatcacctcaaacgtggtttatggtaagaaaacgggtaataca
ccagatggtcgtcgttcaggtgcaccatttgcaccgggcgcaaacccaatgcatggccgt
gatgaaaaaggtgcaatcgcctcattaacctctgtggctaagctgcctttcgcccacgca
caggacggtatctcttacaccttctccatcgtgccaaatgcattaggtaaagatgaagat
ggtcgccgcactaacttagcggcactgatggacggatattttgcccataacgaaggacac
gaaggcggtcaacacttgaacgtcaacgtgatgaaccgtgaaatgcttgaggatgcggta
gtcaacccagacaagtatccacaactgaccatccgtgtttctggttatgcagtgcgcttc
aactcgctgactccagaacagcagcaagatgtgatcacgcgtacattcacaaaaggtctg
taa

DBGET integrated database retrieval system