KEGG   Shewanella oneidensis: SO_0021Help
Entry
SO_0021           CDS       T00099                                 

Gene name
fadB
Definition
(RefSeq) aerobic fatty oxidation complex 3-hydroxyacyl-CoA epimerase alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
son  Shewanella oneidensis
Pathway
son00071  Fatty acid degradation
son00280  Valine, leucine and isoleucine degradation
son00281  Geraniol degradation
son00310  Lysine degradation
son00362  Benzoate degradation
son00380  Tryptophan metabolism
son00410  beta-Alanine metabolism
son00640  Propanoate metabolism
son00650  Butanoate metabolism
son00903  Limonene and pinene degradation
son00930  Caprolactam degradation
son01040  Biosynthesis of unsaturated fatty acids
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01130  Biosynthesis of antibiotics
son01200  Carbon metabolism
son01212  Fatty acid metabolism
Module
son_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SO_0021 (fadB)
   00650 Butanoate metabolism
    SO_0021 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SO_0021 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SO_0021 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SO_0021 (fadB)
   00310 Lysine degradation
    SO_0021 (fadB)
   00380 Tryptophan metabolism
    SO_0021 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SO_0021 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SO_0021 (fadB)
   00281 Geraniol degradation
    SO_0021 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SO_0021 (fadB)
   00930 Caprolactam degradation
    SO_0021 (fadB)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SO_0021 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SO_0021 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SO_0021 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SO_0021 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1167919
NCBI-ProteinID: NP_715663
UniProt: Q8EKR9
Position
complement(24493..26643)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQQSNIQALVLTSG
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGNEQRAEDALK
VGAVDAVVAPEALEVAAIQMLKDAVAEKLDWQARRQRKLSPLTLPKLEAMMSFTTAKGMV
FSVAGKHYPAPMAAVNVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQFVK
GKAKKAGKLAKAVNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPALEYAPVKHADVVVEAVVEHPKVKAQVLAEVEQYVSE
DAIIASNTSTISISLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSRGKP
KKDVDPTSYELLKAAFGEQKAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgatagagaaacactcgcctcactcgat
gccgcattagacagcatcaaacaacaatcaaacattcaggcattagtgctcacatcaggt
aaagatacctttatcgtcggcgctgacattactgaatttttaggcttattcgcacaagat
gatgcagtactgctctcttgggttgaacaggccaacgccgtattcaataaactcgaagat
ttacctttcccaactgcttcagccattaaaggttttgccttaggcggcggttgtgaaacc
attttagcgacagatttccgtattgctgacaccacggcaaaaatcggcttacctgaaacc
aaactgggtattatcccaggctttggcggtactgtacgtctaccacgcgtgattggtgct
gacaacgctctcgagtggatcaccacaggcaatgagcagcgcgctgaagatgcattaaaa
gtcggtgccgttgacgccgttgttgcaccagaagccttagaagttgcggcgattcaaatg
ctcaaagatgctgtcgcagaaaagcttgattggcaagcgcgtcgccaacgcaaattatcg
ccactgacactgcctaaactcgaagccatgatgtctttcactacggctaaaggcatggtt
ttctctgtcgcaggcaaacattacccagcaccaatggcagcggtaaacgtagttgagcaa
gcagcaaccaaaggccgcagcgacgcattacaaattgagcatcaggctttcatcaagtta
gctaagactgatgtggccaaggcgcttatcggtatcttccttaatgatcaattcgttaaa
ggcaaagccaagaaagctggcaagctggccaaagcagtaaatagcgccgccgtattaggt
gcaggcatcatgggcggcggcatcgcttaccaaagcgccagcaaaggcacgccgatcgtg
atgaaagatattgcccagccagcattagatttaggtctcaatgaagcggcaaaactgcta
tcagcgcaagttgcccgtggccgctctacccctgaaaaaatggcaaaggtactgaacaac
atcaccccagctctagaatatgcaccagtgaaacatgccgacgtggttgttgaagccgtg
gttgagcatccaaaagtgaaagcacaggtactggcagaggttgaacaatacgtcagtgaa
gatgcgattatcgcttctaacacttcaacgatttcaatcagcttactcgctaagagcatg
aagaagccagagcgtttctgcggtatgcacttcttcaaccctgtgcacaaaatgccattg
gttgaagttatccgtggcgagcacagctcagaagaaaccatcgcatcagttgtcgcttac
gccagcaaaatgggtaaaaccccaatcgttgttaacgattgcccaggcttcttcgttaac
cgcgtcctcttcccttactttgccggctttaatggtctactcgccgaaggtggcgacttt
gctgctatcgataaagtgatggaaaaacaattcggctggccaatgggccccgcttatctg
ctagacgttgtcggcctagatacaggtcaccacgcgcaagcagtaatggccgaaggcttc
cctgatcgtatgggcaaatctggcaatgacgcgattgacgtgatgtttgagaacaaacgt
ctcggccaaaagaacggtaagggtttctacgcttactcagtggatagccgcggcaagcca
aagaaagatgtcgacccaaccagctatgagctgctgaaggccgcttttggtgagcaaaaa
gcattcgatgcggatgaaatcatcgcccgcactatgatcccaatgattatcgaaaccgtt
cgctgtttagaagaaggcattgtggcatcacctgccgaagcggatatgggcttagtctac
ggtttaggcttcccgccattccgtggtggtgtgttccgttacttagacaccatgggcgtt
gccaactttgtggctttagcagacaaatacgcgcatttaggtggtttgtatcaagtcacc
gacgccatgcgtgcccttgcagccaacaacggtagctactaccaagcctaa

DBGET integrated database retrieval system