KEGG   Shewanella oneidensis: SO_0228
Entry
SO_0228           CDS       T00099                                 

Gene name
fusA
Definition
(RefSeq) translation elongation factor G FusA
  KO
K02355  elongation factor G
Organism
son  Shewanella oneidensis
Brite
KEGG Orthology (KO) [BR:son00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:son03012]
    SO_0228 (fusA)
   03029 Mitochondrial biogenesis [BR:son03029]
    SO_0228 (fusA)
Translation factors [BR:son03012]
 Eukaryotic type
  Elongation factors
   SO_0228 (fusA)
 Prokaryotic type
   SO_0228 (fusA)
Mitochondrial biogenesis [BR:son03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SO_0228 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    SO_0228 (fusA)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_III EFG_C GTP_EFTU_D2 RF3_C GTP_EFTU_D4 MMR_HSR1 Slu7
Other DBs
NCBI-GeneID: 1168111
NCBI-ProteinID: NP_715868
UniProt: Q8EK71
Position
241889..243985
AA seq 698 aa
MARTTPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATTDWMVQEQERG
ITITSAAVTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGASGVE
PQSETVWRQADKYRVPRIVFVNKMDRAGADFERVVKQIRTRLGATCVPIQLNIGAEENFT
GVIDLIKMKAINWNEADQGMTFSYEAIPAHLTAKAEEMHEFLVEAAAEASDELMDKYLEE
GTLSEEEIKKALRQRTINNEIVLATCGSAFKNKGVQAVLDAVVEFLPAPVDVPPIKGIDD
NEQEVERPSDDNAPFAALAFKIATDPFVGTLTFIRVYSGVLESGSGVYNSVKQKRERIGR
IVQMHANDRTELKEVRAGDIAAAIGLKEVTTGDTLCDNDHKVILERMEFPEPVITIAVEP
KSKADQDKMGIALQKLAAEDPSFRVETDEESSQTLISGMGELHLDIIVDRMRREFGVECN
VGKPQVAYRETIRGSVEAEGKFVRQSGGRGQFGHVWLKLEPNEEGAGYEFINAIVGGVVP
REFIPAVDKGIQEQMKNGVLAGFPVLDVKVTLFDGSYHDVDSNEMAFKIAGSMGFKKGAL
EAKPVLLEPCMKVEVTTPENYMGDVVGDLNRRRGLIEGMDDGFGGIKIIHAVVPLSEMFG
YATDLRSATQGRASYSMEFLKYTDAPQNIAKAIIESRS
NT seq 2097 nt   +upstreamnt  +downstreamnt
gtggctcgtacaaccccaattgagcgttatcgtaatatcggtatttgtgctcatgtggac
gcaggtaaaaccaccacaacagaacgtgttctgttctataccggtttgtctcataaaatc
ggtgaggtgcatgacggcgccgcgaccactgactggatggtgcaagagcaagagcgtggt
attactatcacctcggctgctgtaaccactttctggcgtggtatggatgctcaattcact
gaacaccgcatcaatatcatcgatacccctggtcacgttgacttcactattgaggttgaa
cgttctttgcgcgttcttgacggcgctgttgtggttttttgtggcgcttcaggtgttgag
cctcaatcagaaaccgtatggcgtcaagctgataaataccgcgttccacgcatcgtattt
gtcaacaaaatggaccgtgcaggcgcggactttgaacgtgtagtgaagcaaatcagaact
cgccttggggcaacttgtgttccgatccaattaaacatcggcgcagaagaaaacttcact
ggcgtgatcgacttaatcaagatgaaagccattaactggaacgaagcggaccagggtatg
acgttctcttatgaagcgatccctgcacacttaaccgctaaagcggaagaaatgcatgag
tttctggttgaggcagccgccgaggcctctgatgaactgatggataagtatcttgaagaa
ggcacgctatcagaagaagagatcaaaaaggcactgcgtcagcgtactattaataatgaa
atcgttttagcgacctgtggttctgcatttaagaacaagggcgttcaggcggttcttgat
gcggtagtagaattcttgcctgcacctgttgatgtgcctcctattaagggcattgacgac
aatgagcaagaagttgagcgcccatcagatgacaatgccccctttgcggcgttggcattt
aagattgctacagacccgttcgtgggtactttgacctttattcgtgtttactcaggcgta
ctcgaatcaggctctggcgtttataactctgtcaaacagaaacgtgaacgtattggccgt
atcgtgcaaatgcacgctaacgaccgtacagaattgaaagaagtgcgtgcgggtgatatt
gctgcggctattggactaaaagaagtgaccacgggtgacacactttgtgataacgatcac
aaggtgatcttggaacgcatggagttcccagagccagtaattaccattgccgttgagcct
aagtcgaaagctgaccaagataaaatgggcatcgcactgcaaaagcttgcagctgaagat
ccttcattccgggttgagacagacgaagaatcatcacaaacactgatttctggaatgggt
gagttacacttagacatcatcgtggaccgtatgcgtcgcgaattcggtgtcgagtgcaac
gtaggtaagccacaagtggcctaccgtgagaccattcggggatcagttgaggctgaaggt
aaatttgtgcgccaatcaggtggccgtggacaattcggtcatgtttggttaaaactagag
cctaacgaagaaggcgctggttacgaatttatcaatgcaatcgttgggggtgtggttcca
cgtgaattcattcctgcggttgataaaggtatccaagaacagatgaagaatggcgttctc
gccggcttccctgtgttggacgtgaaggtcactctattcgatggttcatatcatgatgtg
gactcgaatgaaatggcgttcaaaattgcgggttctatgggcttcaaaaagggtgcgctt
gaagcgaaacctgtgttgctcgaaccttgcatgaaagtagaagtaactactccagaaaac
tacatgggtgatgttgttggtgatttaaaccgtcgccgtggtttgattgaaggtatggat
gatggctttggtggcatcaaaataatccatgcagtagtgcctctttctgaaatgtttggt
tatgcaactgatttgcgttctgcaactcagggtcgtgcttcttactctatggagttcttg
aagtacactgatgcaccgcaaaacattgcgaaagcgattattgaatctcgtagctaa

DBGET integrated database retrieval system