KEGG   Shewanella oneidensis: SO_0560Help
Entry
SO_0560           CDS       T00099                                 

Gene name
fhs
Definition
(RefSeq) formate--tetrahydrofolate ligase Fhs
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
son  Shewanella oneidensis
Pathway
son00670  One carbon pool by folate
son01100  Metabolic pathways
son01120  Microbial metabolism in diverse environments
son01200  Carbon metabolism
Module
son_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SO_0560 (fhs)
Enzymes [BR:son01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SO_0560 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 1168429
NCBI-ProteinID: NP_716196
UniProt: Q8EJA7
Position
580496..582208
Genome map
AA seq 570 aa AA seqDB search
MLTDMEISRRAHLKDIAQLGAEFGLLPEEMQLFGNTKAKVDLQVQQRLAGQPKGKLIIVT
AVTPTPHGEGKTVTTIGLTQSLKALGNKVCACIRQPSMGPVFGVKGGAAGGGYAQVVPMQ
ELNLHLTGDIHAVSSAHNLGAAAIASRLYHEMRLGKAEFERQSGLSYLDIDPKGIRWHRV
VDHNDRCLREIEVGLGENNGPAYTSGFDITAASELMAILALSRNLTDMRVRIGKLVLALN
RQGEAVSADELGVAGAMTAIMADAVKPTLMQTLNGAPCLIHAGPFANIAHGNSSVIADDI
ALKLADFVVTEGGFGSDMGFEKFCNIKARQSGLIPSAAVLVTTLKALKANSGLASDTDIN
APDQARLEAGFANLNWHINNVVQYGLPVVVAINRFASDTDAELNWLMEAVRGTAAFGCEL
SEAFSQGEDGAMALAQTVIRACEQPSEFRLLYPDNMELEAKLSTLAELGYGAAGINLSAV
AKQQLQELSALGYAHLPVCMAKTPLSISHDPQLKGVPQGFIVPVRELVLNAGAGFITALV
GNVMTMPGLGLTPGYLKIDIDVDGEIIGLG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccgatatggagatttcgcgccgcgcgcatctaaaagatatcgcacaacttggt
gccgagtttgggttgttgcccgaagagatgcagctatttggcaataccaaggcgaaggtg
gatctgcaagtacagcagcgcttagccgggcaaccaaagggcaaattgattattgttacc
gctgttacgccaacgcctcacggtgaaggtaaaaccgtgacgaccattggtttaacgcaa
tcactcaaggcgctcggcaataaagtgtgtgcctgtattcgccaacccagtatggggcca
gtatttggggtaaaaggtggggctgctggtggcggttatgcccaagttgtgcctatgcag
gagctgaatctgcatctaacgggtgatattcatgctgtgagtagcgctcataatcttggg
gctgcggcgattgcttctcggctttaccatgaaatgcgtttaggcaaggctgaatttgag
cgtcaatctggcttaagctacttagatatcgatccaaagggcattcgctggcaccgggta
gttgatcataacgatcgttgtttacgggagattgaggtgggactgggggaaaacaacggc
cctgcttatacctcagggtttgatattaccgccgcttctgagttaatggccattttggcg
ctaagccgtaatttgactgatatgcgcgtacgtattggcaagctagtgttagcccttaat
cgacagggagaggccgttagcgccgacgaactcggtgtagctggagccatgacagcgatt
atggcggatgcggtaaaacctacgttgatgcaaaccttaaacggtgcgccttgtcttatt
catgcgggaccctttgcgaatatcgcccatggtaactcgtcggttattgccgatgatatc
gccttaaaactggccgattttgtggtgaccgaaggtgggttcggctccgatatgggcttt
gaaaagttctgcaatatcaaagcgcggcagtcggggttaattccgagtgccgcagtatta
gtgaccacattaaaggcgcttaaggccaatagcggtttagcgtcggatacggatattaat
gcgcctgaccaagcacgtcttgaagccggttttgccaatttaaattggcatatcaataat
gtggtccaatatggtcttcctgttgttgttgctatcaatcgttttgccagcgatacggac
gccgagctcaactggttaatggaagccgtgcgtggtactgcggcatttggctgcgaactc
agcgaagcttttagccaaggtgaagatggggcgatggctttggcacaaaccgtaattcgc
gcttgtgaacaaccaagtgagtttaggttgctgtatcccgataatatggagttggaagct
aaattatcgaccttagcagaattaggttatggcgcagccggtataaatttatccgctgtg
gcaaaacagcaattacaggagctgagtgcgctcggttatgcgcatttgcccgtgtgtatg
gcaaagacccctttatcgatcagtcacgacccccagcttaaaggtgtccctcaaggtttt
atcgtgccagtgcgtgaattagtgttaaatgcgggcgctggatttatcacggcacttgtg
ggcaatgtgatgacaatgccagggcttggattaaccccaggctatttaaaaatagatatc
gatgtcgatggtgagattattggactcggttaa

DBGET integrated database retrieval system