KEGG   Shewanella oneidensis: SO_1127
Entry
SO_1127           CDS       T00099                                 

Gene name
dnaJ
Definition
(RefSeq) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
son  Shewanella oneidensis
Brite
KEGG Orthology (KO) [BR:son00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:son03110]
    SO_1127 (dnaJ)
   03029 Mitochondrial biogenesis [BR:son03029]
    SO_1127 (dnaJ)
Chaperones and folding catalysts [BR:son03110]
 Heat shock proteins
  HSP40 / DNAJ
   SO_1127 (dnaJ)
Mitochondrial biogenesis [BR:son03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SO_1127 (dnaJ)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP DUF5351 Cytochrome_C7 SCP_3
Other DBs
NCBI-GeneID: 1168959
NCBI-ProteinID: NP_716752
UniProt: Q8EHT6
Position
1170781..1171917
AA seq 378 aa
MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA
NKKAAYDQFGHAGVDPNRGGGGGYGGAGDFGDIFGDVFGDIFGGGRRGGGQRQAARGSDL
RYNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGTSATTCTTCHGQGQVQMRQGFF
TVQQPCPTCHGRGKIIKDPCAKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLAGEGEAGEF
GAPAGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKVSLKIPAET
QTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATLTGESKKHSP
KAEGFFDGVKKFFQDLNS
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtcaaagcgagattattacgaagtattaggcgttggccgtgacgccagcgagcgtgaa
attaaaaaagcctacaagcgtttggcgatgaagtttcaccccgatcgcaaccctggtgat
aaagctgccgaagcgagcttcaaagaagttaaagaagcctacgaaatcctaaccgatgcc
aacaaaaaagcggcctatgaccagtttggtcatgcgggtgtggatcccaatcgcggcggc
ggtggtggctatggcggcgcgggagatttcggtgatattttcggtgatgtctttggcgat
attttcggcggtggacgccgtggcggcggtcaacgccaagcggcccgcggctcagattta
cgttacaacctagagttatcactggaagaagccgttaaaggcctcaccaaagaactgcgt
atcccaaccttagccagctgtgatgtatgtgacggcagcggtgcgaaaaaaggcacctcg
gcgaccacctgtacaacctgtcatggtcaaggccaagtgcaaatgcgccaaggtttcttt
accgtgcaacagccttgtccaacctgtcatggtcgcggcaagatcattaaagatccttgc
gctaagtgccatggtgatggtcgtgtcgagaagacgaagacgctgtcagttaagatccca
gctggtgtcgacactggtgaccgtatccgtttagcaggtgaaggtgaagcgggcgagttt
ggcgcgccagcgggcgatttatatgttcaggtcagtgtacgtgaacatgccatctttgtt
cgcgatggcaacaacctctactgcgaagtgccgatttcattcagtaaagcggcgctcggc
ggcgagattgaagtcccaacactggatggcaaagtcagcctgaagatccctgccgaaact
caaacgggccgtatgttccgtctgcgtggtaaaggggttaaatcggttcgcagccatgcc
gttggcgacttgctctgcaaagtcgtgatggaaacgccagtcaacctaaacgagcgtcag
aaagaactactgcgtgagtttgaggcgaccttaaccggcgaatcaaagaagcacagccca
aaggctgaaggcttttttgatggcgtgaagaagttcttccaagacctaaatagctaa

DBGET integrated database retrieval system