KEGG   Shewanella oneidensis: SO_1523
Entry
SO_1523           CDS       T00099                                 

Gene name
nadF
Definition
(GenBank) NAD kinase NadF
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
son  Shewanella oneidensis
Pathway
son00760  Nicotinate and nicotinamide metabolism
son01100  Metabolic pathways
son01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SO_1523 (nadF)
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     SO_1523 (nadF)
SSDB
Motif
Pfam: NAD_kinase
Other DBs
NCBI-ProteinID: AAN54584
UniProt: Q8EGS1
Position
complement(1599470..1600348)
AA seq 292 aa
MTTKFHTIGLIGKPHHPGTNQTLKRLHHWLTMQGYEVLVEERVATELGPHIVAVDLLEIG
ERCDLAIVVGGDGNMLGAARVLARFEVGVIGVNRGNLGFLTDLPPDAFEEALAKVLDGEF
DTEHRFLLEAEVYRHGQLKASNTAVNEAVLHPGKIAHMIEFEVYIDNQFMYSQRADGMIV
STPTGSTAYALSAGGAILTPNLQALILVPMFPHTLSCRPIVVDACSTIKMVVSPENGENL
EVSCDGHVHLAVLPGDEIIVRRSSEQLRLIHPKGHNYFHVLRSKLGWGSKLF
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaccacaaagttccacaccattggcctaattggcaagccgcaccacccagggacaaat
caaaccctcaaacgtctgcaccattggctgacgatgcaaggctatgaagtccttgtagaa
gaacgggtagcgactgagttagggccacatattgtggcggtcgatttattagagattggc
gagcgctgtgatttagccatagtcgttggcggcgatggcaatatgctcggcgcagctagg
gtgcttgcacgctttgaggtcggtgtgattggcgtaaaccgcggtaacctcggtttttta
acggatttaccacctgatgcctttgaagaagccttagctaaagtgctcgacggtgaattc
gataccgagcaccgttttttactcgaggcagaggtttatcgtcatggtcagctaaaagcc
agtaataccgcggtcaatgaggccgttctgcatccgggaaaaatcgcccatatgattgaa
tttgaagtctatattgacaaccaattcatgtacagccagcgcgccgatggcatgatagtt
tcaacacctacaggctctactgcctatgccctgtcagcgggaggggcgattctcaccccc
aatttacaagcattaattttagtccctatgtttccgcacaccttatcatgccgcccaatc
gtggtggatgcttgtagcaccataaaaatggtcgtttcacctgaaaatggcgaaaacctc
gaggttagctgcgatggccatgtgcatttagcagtattacccggtgatgagatcatcgtg
cgtcgtagctctgaacaactcagacttatccaccccaaaggccataactacttccatgtg
ttacgtagcaaacttggctggggcagtaagttattttga

DBGET integrated database retrieval system