KEGG   Shewanella oneidensis: SO_1665Help
Entry
SO_1665           CDS       T00099                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
son  Shewanella oneidensis
Pathway
son00040  Pentose and glucuronate interconversions
son00052  Galactose metabolism
son00500  Starch and sucrose metabolism
son00520  Amino sugar and nucleotide sugar metabolism
son01100  Metabolic pathways
son01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SO_1665 (galU)
   00052 Galactose metabolism
    SO_1665 (galU)
   00500 Starch and sucrose metabolism
    SO_1665 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SO_1665 (galU)
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SO_1665 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 1169458
NCBI-ProteinID: NP_717276
UniProt: Q8EGD9
Position
complement(1752229..1753137)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLKTDNLASMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKEETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgccggacttggcactcgtatg
cttcctgcgactaaagctatccctaaggaaatgctacccgttgttgataagccattgatc
caatatgtcgttagtgaagccatcgctgcgggtatcaaagaaattgttctcgtgacccac
gccagtaaaaactccatcgaaaaccatttcgacaccagttttgaattagaggcgcaacta
gagcgccgcgtgaaacgtcaattgctcgaagccgtgcaatccatttgccctaaagatgtc
acagtgatcagcgtgcgccaatcccaagctaaaggcttaggtcatgcgattttatgcgct
aaatccgtggtaggtgatgcaccttttgccgtattactgccagatgtgattatcgatgag
gccagttgcgacttaaaaaccgataaccttgcctctatggtaagcctgtttgatgaaact
caagtcggtcaaatcatggttgaaggtgtgccgcatcatttagtaaatcaatatggtatt
gccgatgtgaacggccacgatttgcagcctggtgaatcagagccattagtcgagctggtt
gaaaaaccaccggttgatgaagcgccatctaacttagccgttgttggccgttacgtgtta
ccggcggcaatttggccactgcttgccaaaacaccagcaggcgcaggagatgaaatccaa
ttaactgacgcgattgcaatgttaatgaaggaagaaacggtaaacgcttactacatgcaa
ggtaagagtcacgactgcggtaataagcaaggctatatgcgcgctaacgtggaatacgcg
ctgcgccacagcgaaatcggtgaagattttgcccactacttaaaaacagttgtaaaggga
attaaataa

DBGET integrated database retrieval system