KEGG   Shewanella oneidensis: SO_1677Help
Entry
SO_1677           CDS       T00099                                 

Gene name
ivdA
Definition
(RefSeq) 3-ketoacyl-CoA thiolase IvdA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
son  Shewanella oneidensis
Pathway
son00071  Fatty acid degradation
son00072  Synthesis and degradation of ketone bodies
son00280  Valine, leucine and isoleucine degradation
son00310  Lysine degradation
son00362  Benzoate degradation
son00380  Tryptophan metabolism
son00620  Pyruvate metabolism
son00630  Glyoxylate and dicarboxylate metabolism
son00640  Propanoate metabolism
son00650  Butanoate metabolism
son00900  Terpenoid backbone biosynthesis
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01130  Biosynthesis of antibiotics
son01200  Carbon metabolism
son01212  Fatty acid metabolism
son02020  Two-component system
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_1677 (ivdA)
   00630 Glyoxylate and dicarboxylate metabolism
    SO_1677 (ivdA)
   00640 Propanoate metabolism
    SO_1677 (ivdA)
   00650 Butanoate metabolism
    SO_1677 (ivdA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SO_1677 (ivdA)
   00072 Synthesis and degradation of ketone bodies
    SO_1677 (ivdA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SO_1677 (ivdA)
   00310 Lysine degradation
    SO_1677 (ivdA)
   00380 Tryptophan metabolism
    SO_1677 (ivdA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SO_1677 (ivdA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SO_1677 (ivdA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SO_1677 (ivdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:son04147]
    SO_1677 (ivdA)
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SO_1677 (ivdA)
Exosome [BR:son04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SO_1677 (ivdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt PDT
Motif
Other DBs
NCBI-GeneID: 1169469
NCBI-ProteinID: NP_717288
UniProt: Q8EGC7
Position
1763186..1764376
Genome map
AA seq 396 aa AA seqDB search
MSTELLNQEIVIVAAKRTPMGSFQGSLSGITSLSLAATAIKALLADTQVAPDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARAGIRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPALFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMTKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaactattaaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtagttttcaaggcagtttgtctggcatcacttctctgagcttagcggccacagcaatc
aaagccctgttagccgatacccaagttgcgcctgacaaggtcgatgaggtgttgatgggc
tgcgtattgccagcgggtcttggtcaagcgcctgcgcgccaagcaaccttaggggcaggt
ttaccgctgtctgtgggtgcaaccacagtgaacaaggtctgtggttcagggatgaaaacg
gtgatgcttgcccatgatttgattaaagcgggcagtgctaaggtggtgattgctggtggt
atggaaagcatgagccaagcaccttacttgctcgacaaagcgcgcgctggtatacgtatg
ggccatggcaaagtgttagatcatatgttcctcgacggtttagaagatgcttacactggc
ggcgctatgggcacattcgcccagaaaaccgccgatgaatttggtatcactcgcgagcaa
atggatgcgtttgctttaagctcactcgaaaaagccaacgctgccattaattctggtgct
ttcaaaacggagatagtgcccgtaacggtaagcgatcgccgtggtgacgtgactattgat
accgatgagcagccaggtaacgctcgccctgaaaaaatccccacgttgcgtccagccttt
gctaaagatggcactattactgcggcaaactccagctcgatttccgatggtgcagcggcg
ctgatgttaacaacgcgcgccaatgctgagcagttaggcttaactgtgctcgccaccatc
aagggccacactacccatgcgcaggagcctgcactttttaccaccgcacccgttggcgcg
atggcaaaactattgagtaatgtgggctggtcaaaggatgaagttgatctgtttgagatc
aacgaagccttcgccatggtgactatgctggccgtttctgaattaggtttagatatgaca
aaagtcaacgtgaatggcggcgcttgtgccttaggtcatcctatcggttgctcgggcgcg
cgtttactggtgaccttaatccatgcacttaaagcccgcggacttaagcgcggtgtagcg
tcgctctgtatcggtggtggtgaagcgacggctatggctattgaagtctaa

DBGET integrated database retrieval system