KEGG   Shewanella oneidensis: SO_1786Help
Entry
SO_1786           CDS       T00099                                 

Gene name
glnS
Definition
(RefSeq) glutaminyl-tRNA synthetase GlnS
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
son  Shewanella oneidensis
Pathway
son00970  Aminoacyl-tRNA biosynthesis
son01100  Metabolic pathways
Module
son_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:son00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SO_1786 (glnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:son01007]
    SO_1786 (glnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:son03016]
    SO_1786 (glnS)
Enzymes [BR:son01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     SO_1786 (glnS)
Amino acid related enzymes [BR:son01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SO_1786 (glnS)
Transfer RNA biogenesis [BR:son03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SO_1786 (glnS)
 Prokaryotic Type
   Other AARSs
    SO_1786 (glnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Motif
Other DBs
NCBI-GeneID: 1169559
NCBI-ProteinID: NP_717395
UniProt: Q8EG26
Position
1872356..1874026
Genome map
AA seq 556 aa AA seqDB search
MSHVDTEVRPSNFIRNIIDEDLKSGKHTNVQTRFPPEPNGYLHIGHAKSICLNFGIARDY
QGLCNLRFDDTNPEKEDIDYVNSIQADVRWLGFQWDGEVRYSSNYFDQLHQYAVELINKG
LAYVCFLNADETREYRGTLKEPGKNSPYRDTPVEENLRLFGKMRLGEFKEGECALRAKID
MASPFMCMRDPVIYRIRFAHHHQTGDKWCIYPMYDFTHCISDALEHITHSLCTLEFQDNR
RLYDWVLDNLDDFQAPNRTRQYEFSRLNLEYTLMSKRKLNDLVTRKLVTGWDDPRMPTIA
GLRRRGYTPASIREFCQRIGITKQENMIEAAMLDACIREELNEHAPRAMAVLRPLKVVIE
NYPEGQIETIQAASHPSDESMGTRELAFGREIFIDVADFREEANKQYKRLVMGKEVRLRN
AYVIKAERCDKDSEGNITTVYCSYDADTLGKNPADGRKVKGVIHWVEATTAKPAQFRLYQ
RLFTDPNPAAAETVDEVLNPNSLEVVNGLVEASLANAPAEKAYQFEREGYFCADNKDSSA
DHLVFNLTVALRDSFE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgtggacactgaagtacgtccgagtaactttattcgtaatatcattgatgag
gatctgaaaagcggtaagcacaccaatgtgcagacgcgttttccacccgagccaaatggt
tatttacatataggtcatgctaagtccatctgtttgaactttggcatcgcccgcgattac
caaggtctctgtaacttacgatttgatgataccaaccctgaaaaagaagacatcgattat
gttaattctattcaggcggatgtgcgttggttgggattccagtgggatggtgaggtgcgt
tattcctctaattatttcgaccaattacatcaatatgccgttgagttaattaataaaggc
ctagcctatgtgtgtttcctcaatgccgatgaaacccgtgaataccgtggtacgttaaaa
gaaccaggcaaaaatagcccttatcgtgatacacctgtggaagaaaacctgcgcttattt
ggaaaaatgcgtctgggtgaattcaaagaaggtgagtgtgcgctgcgtgctaaaatcgac
atggcatcgccttttatgtgtatgcgcgatccggtgatttatcgtattcgttttgctcat
catcaccaaacgggcgataagtggtgcatttacccaatgtacgactttactcactgtatc
tctgacgccctggagcatattacccattctctgtgtacgcttgagttccaagataaccgt
cgtctatatgactgggtgctggacaatttagatgatttccaagcgccaaatcgtactcgt
caatatgagttttctcgcttaaatcttgaatatacgctgatgtctaagcgtaaattaaat
gacttagttacgcgtaaattagtgactggctgggatgatccgcgtatgcctacgattgct
ggtcttcgtcgtcgtggttatacccctgcgtctattcgtgaattttgccaacgtattggt
atcaccaagcaagaaaacatgattgaagcggcgatgctcgatgcctgtatccgtgaagag
ctaaacgagcatgcaccccgtgcgatggccgtattgcgtccattaaaagtggtgattgag
aactaccctgaaggtcaaatcgagactattcaagcggcttctcaccctagcgatgaaagt
atggggacgcgtgagttggcttttggtcgtgagatctttattgatgtggcagatttcaga
gaagaagccaataagcaatacaagcgtttagtgatgggcaaagaagtgcgtctgcgtaac
gcttatgtgatcaaggctgagcgttgtgataaagacagcgaaggcaatatcaccacagtt
tactgtagctatgatgctgatactttaggtaaaaatcctgccgatggtcgcaaggtgaag
ggcgtaatccattgggttgaagctactacggctaaacctgcacagttccgcttataccaa
cgtttgttcactgatccaaatccagctgcggctgagacagtggatgaagtactcaaccct
aactcacttgaagtggttaatggtttagtcgaagcaagccttgcgaatgcgccagcggaa
aaagcttatcagtttgaacgtgaaggttatttctgtgcggacaacaaagactcatcagcc
gatcatttagtgtttaacctaacggttgcactgcgtgactcgtttgaatag

DBGET integrated database retrieval system