KEGG   Shewanella oneidensis: SO_2619
Entry
SO_2619           CDS       T00099                                 

Gene name
metG
Definition
(RefSeq) methionyl-tRNA synthetase MetG
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
son  Shewanella oneidensis
Pathway
son00450  Selenocompound metabolism
son00970  Aminoacyl-tRNA biosynthesis
son01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SO_2619 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SO_2619 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:son01007]
    SO_2619 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:son03016]
    SO_2619 (metG)
Enzymes [BR:son01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SO_2619 (metG)
Amino acid related enzymes [BR:son01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SO_2619 (metG)
Transfer RNA biogenesis [BR:son03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SO_2619 (metG)
 Prokaryotic type
   Other AARSs
    SO_2619 (metG)
SSDB
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Adenyl_transf Anticodon_1
Other DBs
NCBI-GeneID: 1170321
NCBI-ProteinID: NP_718204
UniProt: Q8EDX2
Position
2754717..2756747
AA seq 676 aa
MATSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRYQKLRGHECHYICADDAHGTPIM
LKAQQLGMAPEEMIAQVNKEHQQDFADFNIAFDNYHSTHSEENRVLASDIYLKLRANGYI
KSKSISQLFDPEQSMFLPDRFVKGTCPKCKSPDQYGDNCDACGATYSPTELINPKSAVSG
ATPVMKDTEHFFFDLPAFEDMLKEWTRSGALQTEMANKLDEWFEQGLQQWDITRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCDKRPELSFDEFWAKDSKAEVYHFIGKDIVYF
HSLFWPAMLYGSGYRQPNSVYAHGYVTVNGAKMSKSKGTFIKARTYLDHLDPEYLRYYYA
AKLSSRIDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFITKRFDGKLAKITDTTLTEVF
LAKQEQIAEFYETREYGKAMREIMALADIANGFVADAAPWQMVKHDDQQEAAHQVCSNAL
NLFRILVTYLKPVLPRLAQDVEAFFQQTLTWDGLGQDMAGHEIAPFKAMMQRVELDKVNA
MVADSKENLQATTEPEAPKGPLATDPISDTINYEDFAKIDLRIARIVKAEHVAEADKLLK
LQLDIGGETRQVFAGIKSAYSPEDLEGKLTVMVANLAPRKMRFGMSEGMVLAAGPGGSDL
WILEPHEGAQPGMRVK
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcaacttcacaacgtaaaattctcgtgaccagcgcacttccctatgcgaacggaccg
attcatttaggtcatatgctggaatacatccagacggatatctggtcgcgttatcaaaag
cttcgtggacatgagtgccactatatttgtgccgatgacgcccacggcacaccgatcatg
cttaaagcccagcaattaggcatggcgcctgaagaaatgatcgcgcaagtcaacaaagag
catcagcaggatttcgccgattttaatatcgccttcgataattatcacagcacccacagt
gaagagaaccgcgtgctggcgagcgatatttacttaaaactgcgcgcaaacggctatatc
aaaagcaagagcatttctcagctatttgaccctgaacagtcgatgttcttgccggaccgc
ttcgtaaaaggcacctgccctaagtgtaaatcgcccgatcaatatggcgataactgtgat
gcctgcggcgcgacctacagcccaacggagctgattaaccccaaatcggccgtctctggc
gcgacgcctgtgatgaaggacactgagcacttcttcttcgacttacctgccttcgaagac
atgctaaaagagtggactcgctccggcgcactgcaaaccgaaatggccaacaaactcgac
gaatggttcgagcaaggcctgcagcagtgggatatcacccgtgatgcaccttactttggc
tttgagatccctgatgcaccgggcaaatacttctacgtgtggttagatgcgcctatcggt
tacatgggttcattcaaaaatctgtgtgacaaacgcccagagctaagcttcgatgaattt
tgggcgaaggattctaaagccgaggtttaccactttatcggtaaagacattgtctacttc
cacagcctgttttggccagcaatgctttatggctctggttatcgtcagccaaatagcgtt
tacgcccacggctatgtgacagtcaatggcgctaagatgtccaaatctaagggcaccttt
attaaggctcgcacttacttagatcacttagatcctgaatatttacgttactactatgcg
gccaaactcagtagccgtatcgacgatttagatctgaatttagaagatttcgcccagcgc
gtgaactcagatctagtcggtaagctagtgaatttagcctcgcgcaccgcaggttttatc
actaagcggttcgatggcaaactcgcgaaaattactgataccacgctaaccgaggtattt
ttagccaagcaagaacaaatcgctgagttctatgaaacccgcgaatacggtaaagcgatg
cgtgaaatcatggcactagcagacatcgccaacggttttgtcgccgatgctgcgccttgg
caaatggtgaaacatgacgatcaacaggaagcggcccaccaagtgtgctcgaacgccctg
aacctgttccgcattttggtgacgtacttaaaacctgtgttaccacgcttagcacaagac
gttgaagccttcttccaacagacgttaacttgggatgggttaggccaagatatggctggc
catgaaattgcgccatttaaagccatgatgcaacgtgttgagttggacaaagtcaatgct
atggtggctgactctaaggaaaacctgcaagccacaaccgagccggaagcacctaaaggc
ccattagcgaccgatccaattagcgacactatcaactatgaagatttcgctaaaatcgat
ctgcgaattgcgcgtattgtcaaagctgaacatgtagccgaagccgacaaactgttaaaa
ctacaattggatatcggtggcgaaacccgtcaggtgtttgcagggatcaaatcggcctac
tcgccagaggatctcgaaggcaagctgacggtgatggttgccaaccttgcaccgcgtaaa
atgcgttttggcatgtcagaaggcatggtactggcagcaggccctggtggtagcgatttg
tggattttagaaccccatgaaggcgcacagcctggtatgcgggtgaagtaa

DBGET integrated database retrieval system