KEGG   Shewanella oneidensis: SO_2713
Entry
SO_2713           CDS       T00099                                 
Symbol
pnuT
Name
(GenBank) thiamin uptake permease PnuT
  KO
K03811  nicotinamide mononucleotide transporter
Organism
son  Shewanella oneidensis
Brite
KEGG Orthology (KO) [BR:son00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:son02000]
    SO_2713 (pnuT)
Transporters [BR:son02000]
 Other transporters
  Others
   SO_2713 (pnuT)
SSDB
Motif
Pfam: NMN_transporter
Other DBs
NCBI-ProteinID: AAN55741
UniProt: Q8EDN0
Position
complement(2831461..2832126)
AA seq 221 aa
MTDLWLTLVNSVNAALGEVHVMTAWEALAVVLAMAYLLLAMKASVWCWAAAFTSTAIYTV
LFWKVALLMESMLNIYYMGMALYGYWLWTQGGDKHQGVKVTTWPLKTHLKLIAATTLVSL
GIGHGMATFTQASFPYLDAATTCFAVMTTYLVAKKVLENWLYWVVIDLVSIYLYLSKGLM
LTSLLFVLYVGLAVVGYFLWRTALAESRLNLNGERAAKLLG
NT seq 666 nt   +upstreamnt  +downstreamnt
atgacagatttatggttaacgctagtcaatagtgttaatgcggctctaggggaagtccat
gtgatgaccgcatgggaagcactcgctgtagtacttgccatggcatatttgcttttggcg
atgaaggcaagcgtatggtgctgggcagcggcgtttaccagcacggccatttacactgtg
ttgttttggaaagtggcattgctgatggagtcgatgctcaatatctattatatgggcatg
gcactttatggctattggctctggacccaaggtggcgataaacatcaaggtgttaaggtg
accacttggccgctgaaaacccatttaaagttaattgcagctacgacgctagtctcactt
ggtattggtcatggtatggcgacctttactcaagcttcttttccttatctcgatgctgcg
accacctgctttgcggtgatgaccacctatttagtcgctaaaaaggtgttggagaactgg
ttgtattgggtggttatcgatctggtgtcgatttatctttacctgagtaaagggctaatg
ctgacatcattattatttgtgctttatgtggggttagctgttgtgggctatttcctatgg
cgcaccgcactggctgagagtcgtctcaatcttaatggcgaacgtgccgctaagttactt
ggttaa

DBGET integrated database retrieval system