KEGG   Shewanella oneidensis: SO_2759
Entry
SO_2759           CDS       T00099                                 

Gene name
upp
Definition
(GenBank) uracil phosphoribosyltransferase Upp
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
son  Shewanella oneidensis
Pathway
son00240  Pyrimidine metabolism
son01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SO_2759 (upp)
Enzymes [BR:son01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     SO_2759 (upp)
SSDB
Motif
Pfam: UPRTase Pribosyltran Pribosyl_synth
Other DBs
NCBI-ProteinID: AAN55785
UniProt: Q8EDI9
Position
complement(2881829..2882455)
AA seq 208 aa
MKVVEVKHPLVRHKIGLMREGDISTKRFRELAAEVGSLLTYEATADFETETVTIEGWNGP
VDVDQIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVGIYRDEETLEPVPYFEKLASD
MNERIALIVDPMLATGGSMIATIDLLKKRGCTSIKALVLVAAPEGIKALEAAHPDVELYT
AAIDRCLNEKGYILPGLGDAGDKIFGTK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaaagttgtcgaggttaaacacccgttagtgcgtcacaaaatcggcttaatgcgtgaa
ggtgacattagcactaaacgtttccgtgagctagccgctgaagtgggcagcttattaacc
tatgaagctaccgcagatttcgaaaccgaaactgttacgattgaaggttggaatggtccg
gttgatgtggatcagatcaagggtaaaaaagtcactgtggtgcctattctacgtgcgggc
ttaggcatgatggatggtgtacttgagcatattccaagtgcgcgtatttcggttgtgggt
atctatcgcgatgaagaaaccttagagccagtgccttactttgaaaagcttgccagcgac
atgaacgaacgtatcgcacttatcgttgaccccatgctcgcgacgggcggctcaatgatt
gcgaccatcgacttactcaaaaaacgtggttgtacttcgattaaagctttggtacttgtg
gcagctccagaaggaataaaggcgcttgaagcggctcatcctgatgtagagctttatact
gcagcaattgatagatgcttgaacgagaagggctatatcctgcctggtttaggtgatgct
ggtgataagatttttggtactaaataa

DBGET integrated database retrieval system