KEGG   Shewanella oneidensis: SO_2896
Entry
SO_2896           CDS       T00099                                 

Gene name
ligA
Definition
(RefSeq) DNA ligase NAD-dependent LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
son  Shewanella oneidensis
Pathway
son03030  DNA replication
son03410  Base excision repair
son03420  Nucleotide excision repair
son03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:son00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SO_2896 (ligA)
   03410 Base excision repair
    SO_2896 (ligA)
   03420 Nucleotide excision repair
    SO_2896 (ligA)
   03430 Mismatch repair
    SO_2896 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:son03032]
    SO_2896 (ligA)
   03400 DNA repair and recombination proteins [BR:son03400]
    SO_2896 (ligA)
Enzymes [BR:son01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     SO_2896 (ligA)
DNA replication proteins [BR:son03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SO_2896 (ligA)
DNA repair and recombination proteins [BR:son03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     SO_2896 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SO_2896 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     SO_2896 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SO_2896 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD HHH_5 PTCB-BRCT HHH 5_3_exonuc DZR_2
Other DBs
NCBI-GeneID: 1170586
NCBI-ProteinID: NP_718468
UniProt: Q8ED70
Position
complement(3017755..3019824)
AA seq 689 aa
MQDIQLDKRLSELLSQAVTPQTAQPLMQALSQSLNEHNIRYYVDDAPSITDSEYDRLMQQ
LKKLEAEYPQFVLADSPTQRVGGLALAKFEQITHLKPMLSLDNAFDEADFTAFHKRVSDR
VGQVSFCCEPKLDGLAVSILYRNGVLERAATRGDGTVGEDITENVKTIKSIPLRLRGNNY
PELVEVRGEAFMPKAAFEALNERARLKDDKQFVNPRNAAAGSLRQLDSKITASRALSFYA
YALGVVEPSSHELAKTHYEQLQQLKSWGLPVSSEIKVCDELNQVFAYYKDILTRRSDLPF
EIDGVVMKVNDIAQQQTLGFVAKSPRWAIAYKFPAQEEMTLLEGVDFQVGRTGAVTPVAR
LKPVFVGGVTVSNATLHNADEIERLGVMVGDTVIIRRAGDVIPQIVAIVPERRSEDAQAI
VFPQHCPVCGSLVERLEGEAVARCSGGLFCEAQRKEAIKHFASRKALDIDGMGDKIVEQL
IDKELVQSPADLFKLTASMMTMLDRMGMKSATNLALAIEAAKTTTLPRFLYALGIREVGE
ATAANLAAHFGSLDALRIATIEQLIEVEDIGEVVAQHVAHFFAQPHNLEVIDALIAAGVN
WPAIEAPSADEQPLKGQTWVLTGTLNQLNRNDAKAQLQVLGAKVAGSVSKNTDCLVAGEA
AGSKLAKAQELGVKVIGEDELLALLAANR
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgcaagacattcaactcgataaacgcctttctgaactgctttctcaagctgttacacca
caaaccgcgcagccattgatgcaggcgctcagccaatctctcaatgaacacaatattcgt
tactatgtggatgatgcgccaagcattaccgattccgaatacgacagattaatgcaacag
cttaaaaagctcgaggcagagtatcctcagtttgtcttagccgattcgccaacccaaaga
gtgggcggcctggcactggccaagtttgagcagattactcatcttaaacccatgttaagc
ctcgataatgcctttgatgaagcggactttacagcgtttcataagcgagtgagtgataga
gtgggtcaagtgagcttttgctgtgagcctaaactcgatggtctcgcggtgagtatttta
tatcgcaacggtgtgcttgagcgcgccgctacccgtggcgatggcactgtgggcgaggat
attaccgaaaacgtcaaaaccattaaatcaattccacttaggttgcgtggcaacaattat
cccgaattggttgaagtgcgcggcgaagcctttatgcccaaggcggcgtttgaggcacta
aatgagcgtgcacgtttaaaggatgacaaacagtttgtgaatccacgtaacgcggcggcg
ggtagtttacgccagctcgatagcaaaattaccgcctcgcgagcgctgtcgttttatgcc
tatgcattaggtgtagttgaaccaagctcccatgaattagccaagacccattatgagcaa
ttacagcaacttaaatcttgggggctgcccgtcagcagcgagattaaagtttgtgatgaa
cttaaccaagtctttgcttattataaagatattttgacaagacgcagtgatttacccttt
gaaattgacggcgtggtgatgaaggttaacgatattgcccagcagcaaaccttaggtttt
gtagcaaagtctccccgctgggcgattgcctataagtttcctgcacaggaagaaatgact
ctgctcgaaggtgtggattttcaagtgggccgcaccggcgccgttacgcctgtggcgcgc
ttaaaacctgtgttcgtcggtggggtaactgtgtctaatgccaccttgcacaatgccgat
gaaatcgagcgtttaggcgtaatggtcggcgatactgtgattattcgccgcgccggtgat
gtgatcccgcaaattgtggccattgtacccgagcgccgctctgaggatgcgcaggcgatt
gtgtttccacaacattgccctgtgtgtggcagcttggtcgagcgtttagagggggaagcg
gtagcccgttgcagtggcggcttattctgcgaggcgcagcgcaaagaagcgattaaacat
tttgcttcccgcaaggcattagatatcgatggtatgggcgacaaaattgttgagcagctc
attgataaagagctggttcaaagccccgcagatctgtttaaactcaccgcctctatgatg
accatgctcgaccgtatgggaatgaagtccgccaccaatttagcgctcgccattgaagcg
gctaaaaccaccaccttgccacgtttcttgtatgctttaggcattcgtgaggtgggtgag
gccactgcggcaaaccttgcggcacactttggtagcctagatgcactgcgcatcgccact
attgaacaattaatcgaggttgaagatatcggcgaagtggttgcccagcatgtagcacat
ttttttgcccagccccataaccttgaggtaatcgatgccttaattgcggcgggggtaaac
tggcctgcgattgaagcgccaagcgccgacgagcaaccattaaaaggacaaacgtgggtg
ttaacgggtaccttaaatcaactcaaccgtaacgatgctaaggcgcaattacaagtctta
ggcgcaaaagtcgcgggcagtgtgtcgaaaaacaccgactgcttagtggcgggtgaagcg
gccggatctaagctggcaaaagcgcaggagctaggcgtgaaggtgattggcgaagacgag
ctactcgctttacttgcggctaatcgttaa

DBGET integrated database retrieval system