KEGG   Shewanella oneidensis: SO_3503
Entry
SO_3503           CDS       T00099                                 
Symbol
nagP
Name
(GenBank) N-acetyl glucosamine transporter NagP
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
son  Shewanella oneidensis
Brite
KEGG Orthology (KO) [BR:son00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:son02000]
    SO_3503 (nagP)
Transporters [BR:son02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    SO_3503 (nagP)
SSDB
Motif
Pfam: MFS_1 MFS_2 Pam17
Other DBs
NCBI-ProteinID: AAN56494
UniProt: Q8EBL0
Position
complement(3653566..3654873)
AA seq 435 aa
MTLDKSQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIA
VTFTALPSAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTL
LQTAVNPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQ
IDEMANGLVLPYLGMAVFIGILALAVKKSPLPELSNEDEVADHTDKSQIKAALSHPNLAL
GVLALFVYVAVEVIAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVISQP
TALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVWPA
VWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLFIL
FYAVKGHKMRSWSAK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgacactcgataaaagccagcagaaaagcagttttctccccatggcgatagtggcagca
ctctttttcatcctcggattcgcaacttggttgaatggatctttgatgccctatttaaaa
caaattttgcaacttaatcccttccaagcttcattaatcctgttttctttctatattgcg
gtgacttttactgcgcttccctcagcttgggtaatccgtaaagtgggctacaaaaatggt
atggccttgggcatgggcgtgatgatgattgctggcttactgtttattcctgcggcgaag
actcaagtcttcgccctatttttatttgcccaattagtgatgggtgcggggcagacgtta
ctgcaaaccgcggtcaacccctatgttgttcgccttgggcctgaagaatctgcggcagcg
cgtgttagtgtcatggggattttgaacaaaggcgcgggggtgattgcgccattagtgttc
tctgcgttgattttagatagctttaaagaccgtattggcacaacgttgacgcaagtgcaa
attgatgaaatggctaatggtttagtcttaccctacttaggtatggctgtgtttatcggt
attttggcgttagcggtaaagaaatccccgctgccagagttatctaatgaagacgaagtt
gctgatcatactgataaaagccaaattaaagcggcattatctcaccctaacttagcgtta
ggcgtgttggcgctgtttgtgtacgttgcggtagaggtgattgctggcgataccattggc
acctttgcattatccttgggtattgatcattatggagtgatgacgtcctataccatggtc
tgtatggttctcggttatatcttagggatattattgattcctcgcgttatttctcaacct
acggcactgatgatttctgcaattcttggcctattgttaacattaggcattctgtttgga
gataacaattcctacgcaattgcaaatcttctattggttccttttggcggtgtagctcta
cctgataccttgttgttgattgccttcttagggttagctaatgcgatcgtatggcctgca
gtatggcctctagccttgtctggtatgggcaagttaacgagcacaggttctgcgctcctt
atcatgggtattgcgggcggtgcctttggtccggtgtcttgggggttaatgagttcggct
acggatatggggcagcagggtggttatatggtgatgttaccttgctacctgtttattctt
ttctatgctgtcaaaggccataagatgcgcagttggtctgctaaataa

DBGET integrated database retrieval system