KEGG   Shewanella oneidensis: SO_3936
Entry
SO_3936           CDS       T00099                                 
Symbol
motX
Name
(GenBank) flagellar rotation associated protein MotX
  KO
K21217  sodium-type polar flagellar protein MotX
Organism
son  Shewanella oneidensis
Pathway
son02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:son00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    SO_3936 (motX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:son02000]
    SO_3936 (motX)
   02035 Bacterial motility proteins [BR:son02035]
    SO_3936 (motX)
Transporters [BR:son02000]
 Other transporters
  Pores ion channels [TC:1]
   SO_3936 (motX)
Bacterial motility proteins [BR:son02035]
 Flagellar system
  Flagellar assembly proteins
   H and T rings
    SO_3936 (motX)
SSDB
Motif
Pfam: Sel1
Other DBs
NCBI-ProteinID: AAN56911
UniProt: Q8EAG6
Position
complement(4081999..4082655)
AA seq 218 aa
MQVFILLSLRVVMLRTALFALLPLVSSMCFAETQAVDIYSQEQLLEMIRSEQYLAKVKQD
ECQLVQDIEARAEVLKQPLYQFLWGEMLNHGTCVKANAVKGMALLREAAEQGSPEAMVKL
AEYYQTGKFVIRNKDRAVNYLLPAAASGSLAARMMLVRLYGEGYGSPRDYEMAYNWLYNN
VFTDEATKKKALSLLQVLAAKMPASAVARAQQEHLRTR
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcaagtattcatcctattgtcattgagagtcgttatgctacgtactgcattatttgcg
ctgctgcccttagtatcttcaatgtgctttgccgagacacaagcagtagatatttattct
caagaacaattacttgaaatgatccgtagtgaacaatatttggcaaaagtcaaacaggat
gagtgccaattagtacaagatattgaagcgcgtgcagaagtcttaaaacagcccctatat
cagtttttgtggggggaaatgctcaatcacggaacctgcgtaaaagccaatgctgtcaaa
gggatggcgttactgcgtgaagcggctgagcaggggagtcctgaggcaatggtaaaactt
gccgagtattatcaaacgggtaagtttgttattcgcaataaggaccgcgcagtcaattat
ttattgccagctgcagcgagcggtagtttagctgctcgaatgatgcttgtacgtttgtac
ggtgaaggttatggtagtccaagggattacgaaatggcctataactggttatataacaat
gtatttaccgatgaggcgacgaagaaaaaagccttatcattactgcaggtgttagcagct
aaaatgcccgccagtgcagtggcgcgggcccagcaagagcacttgcgaacccgttga

DBGET integrated database retrieval system