KEGG   Shewanella oneidensis: SO_3988Help
Entry
SO_3988           CDS       T00099                                 

Gene name
arcA
Definition
(RefSeq) two component signal transduction system controlling aerobic respiration response regulator ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
son  Shewanella oneidensis
Pathway
son02020  Two-component system
Brite
KEGG Orthology (KO) [BR:son00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SO_3988 (arcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:son02022]
    SO_3988 (arcA)
Two-component system [BR:son02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   SO_3988 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 1171620
NCBI-ProteinID: NP_719518
UniProt: Q8EAB9
Position
4126011..4126727
Genome map
AA seq 238 aa AA seqDB search
MQNPHILIVEDEAVTRNTLRSIFEAEGYVVTEANDGAEMHKAMQENKINLVVMDINLPGK
NGLLLARELREINNIGLIFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLTR
VNSAGNEVEEKSSVEYYRFNDWSLEINSRSLVSPQGESYKLPRSEFRAMLHFVENPGKIL
TRADLLMKMTGRELKPHDRTVDVTIRRIRKHFESLPDTPEIIATIHGEGYRFCGNLED
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccgcacattctgatcgttgaagatgaagccgttacccgtaacacgctaaga
agtattttcgaggcagaagggtatgtggtaactgaggccaatgatggcgcagaaatgcat
aaggctatgcaggaaaacaaaattaacctcgtggttatggacattaacctaccaggtaaa
aacggtctgttgttggcacgtgaattacgtgaaatcaacaacatcggtctgatattcctt
acaggccgtgacaacgaagtcgacaaaatccttggacttgaaattggcgcggacgattat
attaccaagccgttcaacccgcgtgaattgacgattcgtgctcgtaatcttctgactcgt
gtgaatagcgctggtaacgaagtcgaagaaaagagttctgtcgaatactatcgtttcaac
gattggagcttagagatcaacagccgttctctcgtaagcccacagggtgaatcttacaaa
ctgccacgtagcgaattccgcgctatgctgcactttgttgaaaacccaggcaaaatctta
actcgtgccgatctactgatgaagatgactggccgggagttaaagccacacgaccgtact
gttgacgtgactatccgtcgtatccgtaagcactttgaaagcttgccagatacgccagaa
atcatcgccaccattcacggtgaaggctaccgtttctgcggtaacttagaagactaa

DBGET integrated database retrieval system