KEGG   Shewanella oneidensis: SO_4123Help
Entry
SO_4123           CDS       T00099                                 

Gene name
argS
Definition
(RefSeq) arginyl-tRNA synthetase ArgS
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
son  Shewanella oneidensis
Pathway
son00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:son00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SO_4123 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:son01007]
    SO_4123 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:son03016]
    SO_4123 (argS)
   03029 Mitochondrial biogenesis [BR:son03029]
    SO_4123 (argS)
Enzymes [BR:son01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     SO_4123 (argS)
Amino acid related enzymes [BR:son01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SO_4123 (argS)
Transfer RNA biogenesis [BR:son03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SO_4123 (argS)
 Prokaryotic Type
   Other AARSs
    SO_4123 (argS)
Mitochondrial biogenesis [BR:son03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SO_4123 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 1171736
NCBI-ProteinID: NP_719652
UniProt: Q8E9Y7
Position
4282929..4284674
Genome map
AA seq 581 aa AA seqDB search
MKSHIQSLLEQTIESFKQQGILPADFEARIQVDRTKDKSHGDLATNVAMMLTKAAGKNPR
ELAQLIIDNLPASAYVAKVEIAGPGFINFFIDDSALANQLQAAIGDEHLGIKLPAPQTVV
VDYSSPNLAKEMHVGHLRSTIIGDSVVRTLEFLGHKVIRQNHVGDWGTQFGMLLAYMEEL
RAANGEQAQLELSDLETFYRAAKLRFDESAEFATRARQLVVALQSGDEYCNKLWREFNDI
SLSHCHEVYERLGVSLTRADVHGESAYNADLEQVVNDLAAKGLLTESNGAKVVFQEEFRT
KEGEPLPVIIQKADGGYLYATTDLAAMRYRSNVLKADRVLYFVDLRQALHFQQVFSLAKL
AKFVREDMSLEHLGFGTMNGEDGRPFKTRTGGVVKLVDLLDEANTRALELVRSKNPDMDE
ATLAEIARVVGISAVKYADLSKNRTSDYIFSFEQMLSFEGNTAPYLLYAYTRVAGIFKRA
TDVDLSQAKIVLEHEKEKDLGNKLAQFGEILSRVVDKGQPHVLCGYLYELAGAFSSFYEA
CPVLAADNDEQKHSRLLLSQLTASTLQKGLNLLGIETLERM
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatatccaatcattacttgaacaaactatcgaatcctttaaacaacaaggt
attttacctgcggattttgaggcccgaattcaagtagatcgaaccaaggataagagccat
ggtgacttggcaaccaacgtagccatgatgctaaccaaagcggcgggtaaaaatccgcgc
gaattagcgcagttgatcatcgacaaccttcccgcctccgcttatgtggcaaaagttgaa
atcgcaggcccaggttttatcaactttttcatcgatgacagcgcactcgctaaccagtta
caagccgccattggcgatgagcatttagggattaaactgcccgcgccacaaactgttgtg
gtggattattcctcaccaaacctcgccaaagagatgcacgtgggtcacctgcgttcaacc
atcattggcgatagcgtggttcgcaccctcgagtttttaggtcacaaagtcatccgtcaa
aaccatgtaggcgactggggcacccaatttggtatgttgctggcttacatggaagaatta
cgtgcagccaatggcgagcaagcccaattagagttatcggatctggaaaccttctaccgc
gccgccaaactgcgttttgacgagtctgccgaatttgctacccgcgcccgtcagctcgtg
gttgcactgcaatcaggtgatgagtactgcaacaaactgtggcgcgaatttaacgatatt
tcgctaagccactgccatgaagtgtacgagcgtttaggtgtgagtttaacccgcgccgat
gtccacggtgaaagcgcctataacgccgatttagagcaagtcgttaacgatttagctgcc
aaaggtttattgactgaaagcaacggcgccaaagtggtattccaagaagaattccgcact
aaagaaggcgagccactgccggttatcattcaaaaagccgatggtggttacctgtacgcc
acaaccgacttagcagctatgcgttaccgctcaaacgtgctcaaggctgaccgcgtgctg
tattttgttgatttacgccaagcgctgcacttccagcaagtatttagcctcgccaaactg
gccaagtttgtccgcgaggatatgtcacttgagcacttaggctttggcaccatgaatggc
gaagatggtcgtccatttaaaacccgcactggtggcgtggtgaaattagttgatctgctc
gacgaagccaacacccgcgcgctggaattagttcgcagcaagaatccagatatggatgaa
gcgacacttgctgaaatcgcccgcgtagtcgggatcagcgcagtgaaatatgctgatctg
tcgaaaaaccgcaccagcgattacatcttcagcttcgagcaaatgctgagctttgaaggc
aataccgcgccttacctgttgtacgcatacactcgcgtagcgggcatcttcaagcgtgcg
accgatgttgacttaagccaagccaaaatcgtactcgaacacgaaaaagagaaagatcta
ggcaacaaactggcgcagtttggtgaaatcctaagccgtgttgtcgacaagggccaacca
catgtgctctgcggctacctctatgaattagcaggtgctttctctagcttctatgaggcc
tgccctgtgcttgctgccgataatgatgaacaaaaacacagtcgtttactgctgtcacaa
ctgacggcgagcactctgcaaaaaggcctaaatctactaggtatcgaaaccctagaacgg
atgtaa

DBGET integrated database retrieval system