KEGG   Shewanella oneidensis: SO_4287
Entry
SO_4287           CDS       T00099                                 
Symbol
motA
Name
(GenBank) stator-force generator of H+ coupled flagellar motor MotA
  KO
K02556  chemotaxis protein MotA
Organism
son  Shewanella oneidensis
Pathway
son02020  Two-component system
son02030  Bacterial chemotaxis
son02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:son00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SO_4287 (motA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    SO_4287 (motA)
   02040 Flagellar assembly
    SO_4287 (motA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:son02000]
    SO_4287 (motA)
   02035 Bacterial motility proteins [BR:son02035]
    SO_4287 (motA)
Transporters [BR:son02000]
 Other transporters
  Pores ion channels [TC:1]
   SO_4287 (motA)
Bacterial motility proteins [BR:son02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    SO_4287 (motA)
SSDB
Motif
Pfam: MotA_ExbB MotA_N
Other DBs
NCBI-ProteinID: AAN57256
UniProt: Q8E9J0
Position
complement(4466658..4467392)
AA seq 244 aa
MSFIGVIVALVFILVGNLIEGGHPSALLDLPAFMIVIGGTIGATVAQFPFSVIIASMKRF
KWLIFPLRTDLNERAEFLIEIAGDVRKGGLLSIEDKIDQIDDPFLHKGLELLVDGYEKDN
IVEILEKEIEFEQHGIEQTVKVYEAMGGYCPTMGIVGAVFGLIHAMGLLDAPDKLGGAIA
VAFIATIYGVAAANIIFLPFGNRYKAFAHQLSLFKEMTLTGITGIADGESPQRLQAQLNP
YLEH
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagttttataggtgtaattgttgcgctagtttttatcctcgtcgggaatctaattgaa
ggtgggcatccaagtgcactattagacctacctgcatttatgatagtcataggcggaacc
attggtgctacagtggcacagttccctttttctgtcattatcgcttcaatgaaacgtttt
aagtggctcatttttcctttacgaactgatttaaacgagcgtgccgaattcttgatcgaa
atcgcaggcgatgtgagaaaaggtggtttactatcaattgaagataagatagatcaaatt
gacgatccttttttacataaaggacttgaattgctagttgatgggtatgaaaaagacaat
atcgtagaaatcttagaaaaagagattgaatttgaacagcatggcatagaacaaactgta
aaagtttatgaggcaatgggtggctattgtcctacaatgggtattgtaggtgctgtattt
ggactcattcatgctatggggttacttgatgcgcctgataaattaggtggtgcaattgca
gtcgcatttattgcgactatttatggggttgctgcggctaatataatcttccttcccttt
ggaaatcgttacaaagcgtttgcacatcagttaagtttatttaaagagatgacgctaaca
ggcataactggtatcgctgacggtgagtctccacaacggttacaagctcaattaaatcca
tatttagagcactaa

DBGET integrated database retrieval system