KEGG   Shewanella oneidensis: SO_4749Help
Entry
SO_4749           CDS       T00099                                 

Gene name
atpA
Definition
(RefSeq) ATP synthase F1 alpha subunit AtpA
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
son  Shewanella oneidensis
Pathway
son00190  Oxidative phosphorylation
son01100  Metabolic pathways
Module
son_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:son00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SO_4749 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:son00194]
    SO_4749 (atpA)
Enzymes [BR:son01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     SO_4749 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     SO_4749 (atpA)
Photosynthesis proteins [BR:son00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SO_4749 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase HAS-barrel ATPase_2
Motif
Other DBs
NCBI-GeneID: 1172325
NCBI-ProteinID: NP_720265
UniProt: Q8E8B8
Position
complement(4960972..4962513)
Genome map
AA seq 513 aa AA seqDB search
MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGSRF
AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRILEVPVGRGLLGRVVNTLGEPIDGKGA
IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI
DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY
SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER
ASRVNEEYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF
NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ
LEHGVRVTELMKQKQYAPMSVAAQAVSIFAAEKGYLKGVELKKVGDFEAALLSYMNSEHA
ALIKLINETGDYNADIEAELKAGLDKFVATQTW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaattccactgaaatcagcgatctgattaagcagcggatcgagcagttcgaa
gtcgttagcgaatctcgtaacgaaggaactatcgttgcggtaagtgacggcattatccgc
atccacggcctagccgatgtgatgcaaggtgaaatgatcgaactgcctggtagccgtttt
gcaatcgcgttgaaccttgaacgtgattctgtcggtgccgtagtaatgggcccttatgct
gatttagcagagggcgtaaaagttaaaactactggccgtattctggaagttccagtcggt
cgtggcctgttaggccgcgtagttaacactctgggtgagcctatcgacggtaaaggagcg
atcgacaacgatggtttctctcctgttgaagtgattgctccaggtgttatcgaacgtaag
tcagtagatcaaccagttcaaactggttataaagccgttgacgctatgatcccaatcggt
cgtggccaacgtgaattgatcattggcgaccgtcaaactggtaaaacagcgatggcgatc
gatgcaatcatcaaccaacgtgattctggcattaagtgcgtgtatgtagcggtaggccaa
aaggcttctactattgctaacgtagtacgtaagctagaagaacacggtgcattagctaac
actatcgttgtggttgcaacagcttctgaagctgcagcactgcaatacttagcaccgtac
tctggttgtgctatgggtgaatacttccgcgaccgcggtgaagatgctctgatcgtatac
gatgacctgtctaagcaagctgttgcttaccgtcagatctcgttactgctgaagcgtcca
ccaggccgtgaagcttatcctggtgacgtattctatctacactctcgtttattagagcgt
gcttcacgcgtaaacgaagagtatgtagaaaagttcactaaaggtgcagtaacaggtaaa
actggttctttaaccgcgctgcctattattgaaactcaggcgggtgacgtatctgcattc
gtaccgaccaacgtaatttcgattactgacggtcagatcttccttgagaccgatctgttt
aactctggcttacgtccagcggttaacccaggtatttctgtttctcgtgttggtggtgcg
gctcagactaagatcatcaagaaactgtctggtggtatccgtaccgctcttgcacagtat
cgtgaacttgctgcgttctcacagtttgcatctgatcttgacgatgcaactcgtgctcaa
ctagagcatggtgtgcgtgttaccgaactgatgaagcaaaaacaatatgctcctatgagc
gtagccgctcaagctgtgtcaattttcgcagctgaaaaaggttacctgaagggcgttgag
ctgaaaaaagttggtgatttcgaagccgctctgctctcgtacatgaacagcgagcatgct
gctttaatcaagcttatcaacgagactggcgattataacgccgatatcgaagctgaatta
aaagctggcctcgacaagttcgtagcaacccaaacctggtaa

DBGET integrated database retrieval system