KEGG   Streptococcus oralis: SOR_0063Help
Entry
SOR_0063          CDS       T01476                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sor  Streptococcus oralis
Pathway
sor00010  Glycolysis / Gluconeogenesis
sor00052  Galactose metabolism
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01130  Biosynthesis of antibiotics
Module
sor_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_0063
   00052 Galactose metabolism
    SOR_0063
Enzymes [BR:sor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SOR_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBY99781
UniProt: F2QGC1
Position
66639..67676
Genome map
AA seq 345 aa AA seqDB search
MKAYTERVFGNHEGKDVLAYRFETDAGYQLEVMTYGATILRYVTPDKAGNFANVILGFDD
FASYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNCNHSGSTGWDSSLFELV
EVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEVSYKVTTDQDTLVNPTNHSYF
NLSGDFTQTVDRHVFQLNTEGIYPIAPDGVPAKTPDANRDVVKHIYNGALLKDIFAEDDE
QIQLVSGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPCFVVYTANFVDESVIIAGQP
MVQHNGIALEAQALPDAIHSDLKDQVILKAGETFTSKTRYELVVK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacacagagcgtgtatttggaaatcatgagggtaaggatgtcttggcctat
cgctttgaaacggatgcaggctatcagctggaggttatgacctatggagcgacgatttta
cgctacgtaactcctgacaaggctggaaattttgccaatgtgattttgggttttgatgat
tttgctagctacgtaggcaatagtcccaagcatggagcaagtgtaggtcctgtagcgggc
cgtattgcaggtgcaacatttgagctcaatggcaagacctatgaccttgaagtcaacaat
gctagcaactgtaaccacagtggttcaacaggttgggattcgagcttgtttgaattggtc
gaggtgagcgaccatggcttgaccctctacacagagcgtacagacgggacaggaggattt
cctggtaatcttaagatttggattagctaccacttggaagaaactggtgcctacgaagtc
agctataaggtgacgacagatcaggatacgctggtcaatccaactaatcacagctacttc
aacttgtctggtgatttcacgcagacagttgaccgccatgtcttccaactaaacacagag
ggcatttacccaattgctccggacggtgttccagcaaaaactccagatgccaatcgcgac
gtggtgaaacacatctacaatggtgctttgttgaaggatatctttgcagaggacgatgag
caaatccagctggtatctggtttggatcacccatttgctcttcctgcaggtcatgacaat
gctggtttcctttatgaccaaaactcaggtcgtttcctacttttcaagacagaggcccct
tgctttgtggtctacacagcaaactttgtggatgagagtgtcatcatagctggtcagcca
atggtacagcacaatgggattgcccttgaagcgcaagctttaccagatgccattcacagc
gacctcaaagaccaagtcattctcaaagcaggggaaactttcaccagcaaaactcgctac
gagcttgttgtaaaataa

DBGET integrated database retrieval system