KEGG   Streptococcus oralis: SOR_0158Help
Entry
SOR_0158          CDS       T01476                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sor  Streptococcus oralis
Pathway
sor00260  Glycine, serine and threonine metabolism
sor00750  Vitamin B6 metabolism
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01230  Biosynthesis of amino acids
Module
sor_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0158 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SOR_0158 (thrC)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SOR_0158 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N DUF4252
Motif
Other DBs
NCBI-ProteinID: CBY99859
UniProt: F2QGJ8
Position
150870..152354
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPLTYPKVDLDFDTLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFANVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLAANKLQFSSANSMNIGRLVPQIVY
YVYAYAQLIKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALSTQGQYELT
DFDTAILELFAAEYATEEETAAEIKRVYDTDAYIEDPHTAVASAVYRKYQVATGDATKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHDISGVAVPPAVDGLETAPVRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgcgatgcgaacaatacagtaacggccagccaagct
attttgcaaggtttggcgacggatggtggtctgtttacacctcttacttatccaaaggtg
gatttggactttgacacattaaaagatgcttcttaccaagaagtggctaaattagttttg
tcagcatttttagatgactttacagctgaggagttggattactgtatcaacaatgcctac
gatagcaagtttgatactccagcgattgcgccattggtgaaactggatgggcaatataat
ttggaattgttccatggttcaacgattgcctttaaagatatggccttgtctatcttgcct
taccttatgacgactgctgctaaaaagcatggtttggagaacaaaatcgtcattttgaca
gcgacatctggtgatactgggaaagcggctatggcagggtttgcgaatgtgcctgggact
gagatcatcgtcttttatccaaaagacggtgtcagcaaggtacaagagttgcaaatgact
actcagactggcgacaatactcatgttatcgctattgatggaaactttgatgatgcgcaa
accaacgtcaaacatatgtttaacgatgtagctcttcgtgaaaagttggctgccaataaa
cttcaattttcatcagctaactctatgaatattggtcgtttggtaccacagattgtttat
tatgtctatgcctacgctcagttgattaagactggtgagattgtggctggtgaaaaggtc
aattttacagtaccaacaggaaactttggaaatatcttggctgccttttatgctaaacaa
atcggtctgccagttggcaaattaatctgtgcttcaaatgacaataatgttttaactgac
ttctttaaaacacgtgtttacgacaagaaacgtgagttcaaggtaacgactagtccatct
atggatatcttggtatcttcaaacttggagcgtttgattttccatcttttggggaatgat
gcggttaagacagctgaactcatgaatgccttgagtacacaaggacaatatgaattgaca
gactttgatacagcgattctggaactctttgcagctgaatatgcgactgaggaagaaact
gcggcagaaattaaacgtgtttatgatacagatgcctatatcgaggatccacatacggcg
gttgcctcagctgtttatagaaaataccaagtggctactggcgatgcgactaagacagtg
attgcttcaacagctagtccttacaagttcccagtggttgccgtagaagcggtaacagga
aaagcaggcttgactgactttgaagccttggctcaattacatgacatttcaggagtggca
gtgccaccagcggttgatggccttgaaacagctccagttcgtcataaaacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatctaggactttaa

DBGET integrated database retrieval system