KEGG   Streptococcus oralis: SOR_0228Help
Entry
SOR_0228          CDS       T01476                                 

Gene name
sulC
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sor  Streptococcus oralis
Pathway
sor00790  Folate biosynthesis
sor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SOR_0228 (sulC)
Enzymes [BR:sor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SOR_0228 (sulC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: CBY99915
UniProt: F2QGQ4
Position
215206..215760
Genome map
AA seq 184 aa AA seqDB search
MDTQKIETAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFKTDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaaacggctgtaaaaatgattattgaggctgttggcgaggat
gctaaccgagagggcttgcaggaaacacctgctcgtgtagcccgtatgtaccaagagatt
ttttcaggtcttggccaaactgctgaggaacatttatcaaaatcctttgagattattgat
gataatatggtggtagaaaaggatatttttttccacactatgtgtgaacaccacttcttg
cccttttacgggagagcccacattgcctacattccagatggtcgtgtggcaggcctgtct
aagctagcccgtacggttgaagtttattctaaaaaaccacagattcaagaacggttgaat
atcgaagtggccgatgccttgatggactatctgggggctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagcatgcgtggtgtcagaaaaccaggtactgcaaccttg
acgacagtagctcgcggtctatttaaaacagataaggacctccgagatcaggcttatcgt
ctaatgggactataa

DBGET integrated database retrieval system