KEGG   Streptococcus oralis: SOR_0476Help
Entry
SOR_0476          CDS       T01476                                 

Gene name
trpD
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sor  Streptococcus oralis
Pathway
sor00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01130  Biosynthesis of antibiotics
sor01230  Biosynthesis of amino acids
Module
sor_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SOR_0476 (trpD)
Enzymes [BR:sor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SOR_0476 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE NeuB Rho_N
Motif
Other DBs
NCBI-ProteinID: CBZ00140
UniProt: F2QBX2
Position
450073..450840
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMELEEIQPLRQTYRLAEFLKNHQDRLQVIAEIKKASPSLGD
INLDVDIVQQAQTYEANGAVMISVLTDEVFFKGHLDYLREISSQVGIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAQYFKEGRYYISESSIFTGQDAKRVAPYFNGILVGTALMQA
EDVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagaacagaaggcgcgtgaagtcgagcaaatg
gagctggaggaaatccagcccttgcgccagacctatcgcttggcagaatttttgaagaat
caccaggaccgtttgcaggtaattgctgagatcaagaaggctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagcgaacggcgcagtg
atgatttcggttttgacagatgaagttttctttaaagggcatttggattatttgcgtgag
atttccagtcaggtaggaattccgacgctcaacaaggactttatcatcgatgaaaagcaa
atcatccgtgctcgcaatgccggtgcaacagttatcttgctcatcgtcgcggccttgtca
gaagaacggctcaaggaactgtatgactacgcgacagagcttggtctggaagtcttggtg
gaaactcacaatctagctgaactagaggtagcccacagacttggtgctgagattattggg
gttaataaccgcaacttgaccacctttgaagtcgacttgcagaccagtgtagacttggcc
cagtactttaaggaaggtcgctattacatttctgaatcttctattttcacagggcaggat
gcaaaacgagtagcaccatactttaacggaattttggtgggaacagctctcatgcaggca
gaagatgtagcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system