KEGG   Streptococcus oralis: SOR_0805Help
Entry
SOR_0805          CDS       T01476                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sor  Streptococcus oralis
Pathway
sor00450  Selenocompound metabolism
sor00970  Aminoacyl-tRNA biosynthesis
sor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SOR_0805 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SOR_0805 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sor01007]
    SOR_0805 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sor03016]
    SOR_0805 (metS)
Enzymes [BR:sor01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SOR_0805 (metS)
Amino acid related enzymes [BR:sor01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SOR_0805 (metS)
Transfer RNA biogenesis [BR:sor03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SOR_0805 (metS)
 Prokaryotic type
   Other AARSs
    SOR_0805 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Rrp44_S1
Motif
Other DBs
NCBI-ProteinID: CBZ00467
UniProt: F2QCU9
Position
776885..778882
Genome map
AA seq 665 aa AA seqDB search
MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQK
AEEAGITPQAYVDGMAVGVKELWKLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQNR
LVEFFKSHPDFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYGQEDHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDMKLPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVSMINKYFDGQIPAYVEGVTDFDNALAQVAEQSISDYHTHMEAVDYPR
ALEAVWTLISRTNKYIDETAPWVLAKDEALRDQLASVMSHLAASLRVVAHMIEPFMMGTS
RAVLAQLGLAEVSSLENLSLADFPADVTVVAKGTPIFPRLDMEEEIAYIKEQMESNKPAV
EKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEVSKVEGSDKLLQFRLDAGDGEDRQI
LSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYVSQGMILSAEHDGQLTLLTVDPAVPN
GSVIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagaatttttatattacaacaccgatttactatccgtctggtaaacttcat
atcggttctgcctacacaaccatcgcttgtgatgtcctagctcgctacaaacgcctcatg
ggctacgatgtcttttatctgacaggtcttgatgagcatggtcaaaaaatccagcaaaaa
gcggaagaagctggcatcacacctcaagcttatgttgatgggatggcggttggagtcaaa
gaactctggaaattactcgatatctcatacgataagttcatccgtacaactgatgattac
catgaaaaagttgtagcacaggtctttgaacgcttgcttgctcaagatgatatctacttg
ggcgaatactctggctggtattcagtttcagatgaggaattctttacagaaagccagctt
gcggaagttttccgtgatgaagctggaaatgtaacgggcggtattgctccatcaggtcac
gaggttgaatgggtttcagaagagtcttacttccttcgcctcagcaaataccaaaatcgc
ttggttgaatttttcaaatcacatcctgattttatcactcctgatggtcgcctcaatgaa
atgttgcgtaactttattgagccaggtttggaagacttagcggtttctcgtacaaccttt
acctggggtgtgccagtcccatcaaatcccaaacacgttgtctacgtttggattgatgcc
cttcttaactatgcgactgctcttggttacggtcaagaggatcatgctaactttgacaag
ttctggaacggaacagtcttccacatggtcggaaaagacattcttcgtttccactctatc
tactggccaatccttctcatgatgttggatatgaaattgcctgaccgcttgattgcccac
ggttggttcgtcatgaaagacggcaagatgtctaagtctaaagggaatgtcgtttaccct
gaaatgctagtagaacgttatggactggatccacttcgttactacctcatgcgtagcctt
ccagtcggttcagacggaaccttcactcctgaagactatgtaggccgtatcaactatgaa
ttggcaaatgacctcggaaacctcctcaaccgtacagtttccatgattaacaagtacttt
gatgggcaaatccctgcctacgtagaaggtgtgacagactttgacaatgctcttgcacaa
gtagcagagcaatctatctctgactaccatacacacatggaagcagttgactacccgcgt
gccctagaagcagtatggactcttatctctcgcactaacaaatacatcgatgagacagct
ccatgggtcttggctaaggatgaagcccttcgtgaccaattggcaagtgtcatgagccac
ttggcagccagccttcgtgtcgtagctcacatgattgagccatttatgatgggaactagt
cgcgctgtattggcacaacttggtctagcagaagtttctagcctagaaaacttgagcttg
gcagatttccctgcagatgtgactgttgttgccaaaggaacaccaatcttcccacgcctc
gacatggaagaagagattgcctatatcaaggaacaaatggaaagcaacaaaccagccgtc
gaaaaagaatggaatccagatgaagttgagctcaaactcaacaaggatgaaatcaagttt
gaagactttgataaggtcgagatccgtgtcgcagaggtcaaagaagtttctaaagtggaa
ggttctgataagttgctccaattccgcctagatgctggtgatggtgaagatcgtcaaatc
ctctcaggaattgccaaatactatccaaacgaacaagaattggtcggtaagaaagtccaa
atcgttgccaacctcaaaccacgcaagatgatgaaaaaatatgtcagccaagggatgatt
ctctcagctgaacatgatggacaattaacccttctcacagttgatccagctgtaccaaac
ggaagtgtgattgggtaa

DBGET integrated database retrieval system