KEGG   Streptococcus oralis: SOR_0928Help
Entry
SOR_0928          CDS       T01476                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
sor  Streptococcus oralis
Pathway
sor00770  Pantothenate and CoA biosynthesis
sor01100  Metabolic pathways
Module
sor_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SOR_0928
Enzymes [BR:sor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SOR_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DrsE Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: CBZ00587
UniProt: F2QD69
Position
complement(899477..900028)
Genome map
AA seq 183 aa AA seqDB search
MANILIAVTGSIASYKSADLVSSLKKQGHDVTVIMTQAATEFIQPLTLQVLSHNPVHLDV
MQEPYPNQVNHIEIGKRTDLFIVAPATANTIAKLAHGFADNMVTSTALALPEHVKKLVAP
AMNTKMYDHPATQANLKTLETYGYQIISPKESLLACGDHGKGALADLNTILERIKETLDE
QTL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattctcatcgcagtgacaggttccattgcctcctataaatcagctgaccta
gttagttccttgaagaaacaaggccatgatgtcactgtcataatgactcaggctgctaca
gagtttatccaaccgttgacactacaggtcctctctcacaatcctgtccaccttgatgtc
atgcaggaaccctatcctaatcaagtcaatcatatcgaaataggcaaaagaactgatctt
tttatcgtagcccctgctactgctaataccatcgcaaagttagcccatggatttgcggac
aacatggtgacaagcacagcacttgccttgccagaacatgtcaaaaagttagtcgcacca
gccatgaatacaaaaatgtatgaccatccagcaactcaggctaatctaaaaacattagag
acctatggttatcagattatctctccaaaagaatctctactagcctgtggcgatcacggc
aaaggcgccctagctgacctgaatactattttagaaagaataaaggaaaccctcgatgaa
caaacgctctaa

DBGET integrated database retrieval system