KEGG   Streptococcus oralis: SOR_0932Help
Entry
SOR_0932          CDS       T01476                                 

Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sor  Streptococcus oralis
Pathway
sor00670  One carbon pool by folate
sor01100  Metabolic pathways
sor01120  Microbial metabolism in diverse environments
sor01200  Carbon metabolism
Module
sor_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SOR_0932
Enzymes [BR:sor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SOR_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719 T3SchapCesA
Motif
Other DBs
NCBI-ProteinID: CBZ00591
UniProt: F2QD73
Position
903664..905334
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSIELKPIVDVVEKLGISYDDLELYGKYKAKLSFDKIRAVESNPVGKLILVT
AINPTPAGEGKSTITIGLADALNKIGKKTMIAIREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLHQGNELGIDQRRILWKRVVDLNDRALRHVTVG
LGGPLNGIPREDGFDITVASEIMAILCLATDIEDLKRRLANIVIGYRYDRTPVSVGDLQV
EGALALILKDAIKPNLVQTIYGTPAFVHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLDIKTPNLPTSPDAVVIVATLRALKMNGGVAKDALTEENVEAVRAGFANL
KRHVENIRKFGIPAVVAINEFVTDTEAEIAALKELCASIDVPVELASVWADGAEGGVALA
ETLVKTISENPANYTRLYDNDLSVQEKIEKIVTEIYRGTKVNFEKKAQTQIAQIVQNGWD
KLPICMAKTQYSFSDNPNALGAPENFEITIRELVPKLGAGFIVALTGDVMTMPGLPKRPA
ALNMDVESDGTVLGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaatcgcacagagtattgagttgaagccgatcgttgatgttgta
gagaaattgggtatttcttacgacgatttggaattgtatggaaagtacaaggctaagctt
agctttgataaaattcgtgcagttgagagcaatccagttggaaaattgatcttggttact
gctattaacccaacaccagcgggtgaaggaaagtcaaccattaccatcggtcttgctgat
gccttaaacaaaatcggcaagaaaaccatgattgctattcgcgaaccatctcttggacca
gtaatggggattaagggtggtgcagccggtggtggttatgcccaagtgttgccaatggag
gacatcaaccttcactttaccggggatatgcatgccattacaactgctaacaatgctctt
tctgccttgattgacaatcacttgcaccaaggaaatgagctgggaatcgaccaacgtcgt
attctctggaaacgtgtagtggacttgaacgaccgcgcccttcgtcatgtgaccgttgga
cttggtggtcctctaaacggtattcctcgtgaggatggttttgatattaccgttgcttca
gaaatcatggccattctttgcttggcaacggacatcgaggacttgaaacgtcgtttggcg
aatatcgttattggctatcgttacgatcgtacgccagtttctgttggtgatttgcaggtt
gagggggctttagcattgattttgaaagatgctatcaaaccgaacttggttcagacaatt
tacggtacacctgcctttgtacatggtggtccatttgccaatatcgctcatggatgtaac
tctgttttggcaacaagcacagcccttcgcttagcggactacacagttactgaagctggt
tttggtgcggaccttggtgctgagaaattccttgacattaagacaccaaacttgccaaca
tctccagatgcagttgtcatcgtcgcaacccttcgtgcccttaagatgaatggtggtgta
gctaaagatgctttgacagaggaaaatgtagaagcagttcgcgcaggttttgctaacttg
aaacgccacgttgaaaatattcgtaagtttggtattccagcagttgttgcgattaatgaa
tttgtcactgatacagaagctgaaattgcagccttgaaagaactttgtgcttctattgat
gtgccagttgaactagcaagtgtctgggctgatggggcagaaggtggtgtagcacttgcc
gaaacacttgtcaagacaatctctgaaaatccagccaactatactcgtctttatgacaac
gacctttctgtccaagaaaagattgaaaagattgttactgaaatctatcgcggtacaaaa
gtcaactttgaaaagaaagctcaaacgcaaatcgcccaaatcgttcagaatggttgggac
aaattgccaatctgtatggctaaaactcagtacagtttctctgataatccaaatgcactt
ggagctccagaaaactttgaaattaccatccgtgaattggtacccaaattaggtgcaggc
ttcattgttgccctaactggtgatgttatgaccatgccaggacttccaaaacgtccagcc
gctcttaatatggatgttgaaagtgatggaacggtcctaggcttgttctaa

DBGET integrated database retrieval system