KEGG   Streptococcus oralis: SOR_1230Help
Entry
SOR_1230          CDS       T01476                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase (glutamate 5-kinase)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sor  Streptococcus oralis
Pathway
sor00330  Arginine and proline metabolism
sor00332  Carbapenem biosynthesis
sor01100  Metabolic pathways
sor01130  Biosynthesis of antibiotics
sor01230  Biosynthesis of amino acids
Module
sor_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SOR_1230 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SOR_1230 (proB)
Enzymes [BR:sor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SOR_1230 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CBZ00888
UniProt: F2QE19
Position
complement(1203708..1204817)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKAITQQLAMLHEAGHELILVSSGAVAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLMRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLHRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNS
DPTAKRLEKIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDA
LIEAADETKDGSFFVAQEKGLRTQKQWLAFYAQSQGTIWVDGGAAEALSENGKSLLLSGV
VEVEGNFSYHDIVTVADKETGQSLGKGRVQFGVSALEDMLRSQKAKGVLIHRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacaaacgaatcgtctttaaggtggggacttcgtcgttgacaaatgaagacggg
agtttatcaagaagtaaagtaaaggcaattacccaacaattggctatgttgcatgaggct
ggacatgagttgattttggtgtcatctggggcagttgccgctggatttggtgctttaggt
tttaaaaaacggccgaccaagattgcagataagcaggcctcggccgcagtaggacaaggt
ttgctcctagaagaatacacaaccaacctcctcatgcgccaaatcgtctccgcacaaatc
ttgctgactcaggatgattttgtagataaacgtcgttataagaatgcccatcaggcctta
tctgtattgcttcatcgtggtgccattcccatcatcaatgagaacgacagtgtcgttatt
gatgagctcaaggttggggacaatgatactctgagtgctcaggtagcggctatggtgcag
gcagaccttttggttctcttgacggatgtggacggtctctatactggaaatcccaactca
gatccaacagctaaacgtcttgagaaaatcgagactatcaatcgtgagattattgatatg
gctggtggagcaggttcgtcaaacggtactgggggcatgctgacaaaaatcaaagctgca
actattgcgacggagtcaggggtgccagtctatatctgctcgtccctgaaatcagatgcc
ttgattgaggcggcggacgagaccaaggatggttccttctttgttgcgcaagagaagggt
cttcgtacccagaaacaatggctggccttctatgctcaaagtcagggaacgatttgggta
gatggtggagctgcagaagcactttcagaaaacggaaaaagtctccttttatcaggtgtg
gtagaagtggaagggaacttctcttaccatgatattgttacagtagcagataaagaaaca
ggtcaatctcttggaaagggacgtgtccaatttggtgtctcagccctagaagatatgctc
cgttctcaaaaagctaagggagtcttgattcaccgtgatgactggatttccatcactcct
gaaatccagctgctctttacagaattttag

DBGET integrated database retrieval system