KEGG   Streptococcus oralis: SOR_1873
Entry
SOR_1873          CDS       T01476                                 

Name
(GenBank) Tn916 conserved hypothetical protein
Organism
sor  Streptococcus oralis
SSDB
Motif
Pfam: AAA_10 DUF853
Other DBs
NCBI-ProteinID: CBZ01520
UniProt: F2QFV1
Position
1829696..1832143
AA seq 815 aa
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHA
LQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLL
NDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFK
IRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQR
YLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALS
TVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYKLSYVVRVSAN
DLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFA
NNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMK
NPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLS
TSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMEL
LSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVY
FVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQC
LISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggcatatccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgt
tatgcttactatgagcttgttccttacaattactcatttctaagtccagaacagaaaata
caagtgcatgattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgct
ttacaaatcagtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtc
actggcaagctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaata
tccatgattggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctc
aacgatcaggagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgat
tttgtctatgatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaa
atcctgcgttttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaa
atccgcaggttagataaggacgacttcggctatctgattgaacacctttacggacagaca
ggcactgcctatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacg
ctgattaaatactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcga
tatttgaaaatccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagc
attgtcggagaactggacttcccgtcctctgaaatcttctactaccagcaacagcaattt
acattcccgattgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatct
actgtccgcaataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgat
aatgaaaccagctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaat
ttagaccaaagcaaggaatctatgtacaagctgtcttatgtggtaagggtatcagcaaat
gatcttgacgaactcaaacgtcgttgtaatgaagtgaaagatttttatgacgatttaagc
gtaaaactggtacgaccatttggggatatgctcggcttacatgaagaatttttacctgcc
agcaagcgttatatgaatgattatattcaatacgtgacctctgatttcctcgctggttta
ggttttggtgctactcaaatgctgggggaaaatgaggggatttatgttggctacagctta
gatactggacgcaatgtctatctgaaacctgctcttgccagtcaaggggttaagggttca
gtaaccaatgcgttagcgtcggcttttgttggttcgctgggtggtggtaaatcctttgcg
aataaccttatcgtctattatgcggtgctttatggggcacaagcagtgattgtagaccca
aaagcagaacgtggcagatggaaagaaaccttgccagagatttcccatgaaatcaatatc
gtcactctgacttctgatgagaaaaacaaaggcttacttgacccttatgtgattatgaaa
aatcccaaagattctgaatcactggctattgatattctgacattccttacggggatttcc
tctcgtgatggggaacgcttcccaatccttagaaaagccattcgtgcagtaaccaatagt
gaagtacgagggttgatgaaagtgattgaggaattacgggttgagaatacgccactaagt
accagtatagccgaccatatcgaaagttttacagactatgactttgcacatttattattc
agtaatggttatgtggagcagtctatcagcttagaaaaacaactgaacattatacaggtt
gcggacttggtacttcccgacaaggaaacttcctttgaggaatataccactatggagctt
ttatccgttgctatgctgattgtcattagtacctttgctttagactttatccatacagac
cgaagcattttcaagattgtagatttagacgaagcatggagctttttacaggtagcacaa
ggaaaaacactatctatgaagctggttcgggctggtcgtgctatgaacgctggggtatat
ttcgtgacccaaaatacagacgacctcttagatgaaaaactgaaaaataacctcggctta
aaatttgcatttcgttccactgaccttaacgagattaaaaagaccttagccttttttggt
gtagacccagaggacgaaaacaatcagaagcgattgcgtgatttggaaaacgggcaatgc
cttatcagtgatttatatggtcgtgtcggtgtgatacagttccaccctgtatttgaagaa
ctgctccatgcctttgataccagaccacctgtgcgaaaagaggtgtaa

DBGET integrated database retrieval system