KEGG   Streptococcus oralis: SOR_1947Help
Entry
SOR_1947          CDS       T01476                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sor  Streptococcus oralis
Pathway
sor00071  Fatty acid degradation
sor00072  Synthesis and degradation of ketone bodies
sor00280  Valine, leucine and isoleucine degradation
sor00310  Lysine degradation
sor00362  Benzoate degradation
sor00620  Pyruvate metabolism
sor00630  Glyoxylate and dicarboxylate metabolism
sor00640  Propanoate metabolism
sor00650  Butanoate metabolism
sor00900  Terpenoid backbone biosynthesis
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01130  Biosynthesis of antibiotics
sor01200  Carbon metabolism
sor01212  Fatty acid metabolism
sor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SOR_1947
   00630 Glyoxylate and dicarboxylate metabolism
    SOR_1947
   00640 Propanoate metabolism
    SOR_1947
   00650 Butanoate metabolism
    SOR_1947
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SOR_1947
   00072 Synthesis and degradation of ketone bodies
    SOR_1947
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SOR_1947
   00310 Lysine degradation
    SOR_1947
   00380 Tryptophan metabolism
    SOR_1947
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SOR_1947
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SOR_1947
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SOR_1947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sor04147]
    SOR_1947
Enzymes [BR:sor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SOR_1947
Exosome [BR:sor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SOR_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBZ01594
UniProt: F2QG25
Position
complement(1917594..1918772)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGSLKNVSAVDLGALVIKRALEKANVKPELVDEVIMGNVLGAG
LGQNVARQMSVHAGLPEFTPAFTINKVCGSGLKAVQLAAQAIRCGDADIIVAGGAENMSQ
APYVLPSFRWGGRMGDSKVVDTMIKDGLSDAFNEYHMGITAENVAEEYGISREEQDALAL
ESQKRAVAAIESGRFKEEIIPVVIPQRKGDPIVFDTDEYPRKDTSLESLSKLGPVFKKDG
SVTAGNASGINDGAAAVLVMSAEKAEELGVPVIARIRSYASAGLDPKMMGCGPIYATRKA
LEKGNLTVDDLDLIESNEAFAAQACAVGKTLGFNTDIVNVNGGAIALGHPIGASGCRILV
TLVHEMMKRDAKTGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtggtgattgtttcagcagtgcgaactccaataggctcctttggaggaagt
ttgaagaatgtttcagcagttgatttgggagctttggttataaagagagctttggaaaaa
gccaatgtcaaaccagagctagtagatgaagtgattatggggaatgtcctaggcgcaggt
ttaggtcaaaacgtagctcgtcaaatgagcgttcatgcaggactccctgaatttacacca
gcctttactatcaacaaggtttgtggttccggtttgaaggccgtgcagttggctgctcaa
gcgattcgatgtggcgatgcagatattatcgtagctggtggtgcagaaaacatgagtcag
gctccatacgttttgccaagtttccgttggggtggtcgtatgggagattcgaaagtggta
gataccatgattaaggatggtttgtctgatgcctttaacgaataccatatgggaattaca
gccgagaatgtggctgaagaatatggcatcagtcgagaagagcaagatgctcttgcttta
gagtcacaaaaacgagcagttgcagctatagaatctggccgctttaaagaagagattatt
ccagttgtcattcctcaacgcaaaggcgatcctattgtttttgatacagatgaatatcct
agaaaagatactagcttggagagcttgtctaagctaggtcctgttttcaaaaaagacggt
tctgttacagcgggaaatgcttcaggtatcaatgatggagcagcggctgtcttggtcatg
agtgctgaaaaagcggaagaattaggagtgcccgtgattgcccgcattcgttcttatgca
agtgcaggtttggaccctaagatgatgggatgtggaccgatttatgcaactcgcaaagct
cttgaaaaaggcaatttgacagtcgatgatcttgacttgattgagtcaaatgaagccttt
gctgcccaggcttgtgcggttgggaaaacacttggctttaacacagatattgtcaatgtc
aatggtggtgcgattgctcttggtcacccaattggggcttcaggttgccgtatcctagtg
actctggtacatgagatgatgaaacgtgatgctaaaactggtttagctactctctgtatc
ggaggagggatgggaacagccctcatcgttgaacgttag

DBGET integrated database retrieval system