KEGG   Solanum tuberosum (potato): 102577489Help
Entry
102577489         CDS       T02981                                 

Gene name
PAIN-1
Definition
(RefSeq) beta-fructosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00052  Galactose metabolism
sot00500  Starch and sucrose metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102577489 (PAIN-1)
   00500 Starch and sucrose metabolism
    102577489 (PAIN-1)
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102577489 (PAIN-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 102577489
NCBI-ProteinID: NP_001274993
UniProt: G9IHF4
Position
Un
AA seq 639 aa AA seqDB search
MATQYHSSYDPENSASHYTFLPDQHDSGHRKSLKIISGIFLSSLLLLSLVFFPILNNQSP
DLQSNARSPAPPSRGVSQGVSDKTFRDVVNASHVSYAWSNAMLSWQRTAYHFQPQKNWMN
DPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVW
TGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKYKGNPVLVPPPGIGV
KDFRDPTTAWTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTGMWE
CVDFYPVSTEKTNGLDTSYNGPGVKHVLKASLDDNKQDHYAIGTYDLTKNKWTPDNPELD
CGIGLKLDYGKYYASKTFYDPKKQRRVLWGWIGETDSESADLQKGWASVQSIPRTVLYDK
KTGTHLLQWPVEEIESLRAGDPIVKQANLQPGSIELLHVDSAAELDIEASFEVDKVALQG
IIEADHVGFSCSTSGGAASRGILGPFGIVVIADQTLSELTPVYFYISKGADGRAETHFCA
DQTRSSVAPGVAKQVYGSSVPVLDGEKHSMRLLVDHSIVESFAQGGRTVITSRIYPTKAV
NGAARLFVFNNATGASVTASVKIWSLESANIRSFPLQDL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcagtaccactcaagttatgacccggaaaactccgcctcccattacacattc
ctcccggatcaacacgattccggccaccggaaatcccttaaaatcatctccggcattttc
ctctcctctctccttttgctttctttagtcttctttccgatcctcaacaaccagtcaccg
gacttgcaaagtaacgcccgttcgccggcgccgccgtcaagaggtgtttctcagggagtc
tccgataagacttttcgagatgtcgtcaatgctagtcacgtttcttatgcgtggtccaat
gctatgcttagctggcaaagaactgcttaccattttcaacctcaaaaaaattggatgaac
gatcctaacggtccattgtaccacaagggatggtatcatcttttttatcaatacaatcca
gattcagctatttggggaaatatcacatggggccatgccgtatccaaggacttgatccac
tggctctacttgccttttgccatggttcctgatcaatggtacgatattaacggggtctgg
actgggtccgctaccatcctacccgatggtcagatcatgatgctttatactggtgacact
gatgattatgtgcaagtgcaaaatcttgcgtaccccgccaacttatctgatcctctcctt
ctagactgggtcaagtacaaaggcaacccggttctggttcctccacccggcattggtgtc
aaggactttagagacccgaccactgcttggaccggaccccaaaatgggcaatggctttta
acaatcgggtctaagattggtaaaacgggtattgcacttgtttatgaaacttcaaacttc
acaagctttaagctattggatgaagtgctgcatgcggttccgggtacgggtatgtgggag
tgtgtggacttttacccggtatcgaccgaaaaaacaaacgggttggacacatcatataac
ggcccgggtgtaaagcatgtgttaaaagcaagtttagatgacaataagcaagatcactat
gctattgggacgtatgacttgacaaagaacaaatggacacccgataacccggaattggat
tgtggaattgggttgaagctggattatgggaaatattatgcatcaaagacattttatgac
ccgaagaaacaacgaagagtactgtggggatggattggggaaactgatagtgaatctgct
gacctgcagaagggatgggcatctgtacagagtattccaaggacagtgctttacgacaag
aagacagggacacatctacttcagtggccagttgaagaaattgaaagcttaagagcgggt
gatcctattgttaagcaagccaatcttcaaccaggttcgattgagctactccatgttgac
tcagctgcagagttggatatagaagcctcatttgaagtggacaaagtcgcgctccaggga
ataattgaagcagatcatgtaggtttcagctgctctactagtggaggtgctgctagcaga
ggcattttgggaccatttggtatcgttgtaattgctgatcaaacgctatctgagctaacg
ccagtttacttctacatttctaaaggagctgatggtcgagctgagactcacttctgtgct
gatcaaactagatcctcagtggctccgggagttgctaaacaagtttatggtagttcagta
ccggtgttggacggtgaaaaacattcgatgagattattggtggaccactcaattgtggag
agctttgctcaaggaggaagaacagtcataacatcgcgaatttacccaacaaaggcagtg
aatggagcagcacgactcttcgttttcaacaatgccacaggggctagcgtgactgcctcc
gtcaagatttggtcacttgagtcggctaatattcgatccttccccttgcaagacttgtaa

DBGET integrated database retrieval system