KEGG   Solanum tuberosum (potato): 102577615Help
Entry
102577615         CDS       T02981                                 

Definition
(RefSeq) 5-lipoxygenase
  KO
K15718  linoleate 9S-lipoxygenase [EC:1.13.11.58]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    102577615
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.58  linoleate 9S-lipoxygenase
     102577615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 102577615
NCBI-ProteinID: NP_001275351
UniProt: O49150
Position
Un
AA seq 864 aa AA seqDB search
MNIGQIMGGRELFGGHDDSKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLI
SSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNT
HINEFFLKSLTLEDVPNHGKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYR
ENELLTLRGDGTGKREAWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGR
PPTRTDPKSESRIPLLLSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGT
PNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKD
SKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGL
TVDEAMNNNKLFILNHHDLLIPYLRRINTTITKSYASRTLLFLQDNGSLKPLAIELSLPH
PDGDQFGVTSKVYTPSDQGVESSIWQLAKAYVAVNDAGVHQLISHWLNTHAVIEPFVIAT
NRQLSVLHPIHKLLYPHFRDTMNINASARQILINAGGVLESTVFQSKFALEMSAVVYKDW
VFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYG
SDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVN
FGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEIL
SRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNA
PYTLLFPTSEGGLTGKGIPNSVSI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaatattggtcaaattatgggtggacgtgaactatttggtggccatgatgactcaaag
aaagttaaaggaactgtggtgatgatgaagaaaaatgctctagattttactgatcttgct
ggttctttgactgatatagcctttgatgtccttggccaaaaggtttcttttcaattaatt
agctctgttcaaggtgatcctacaaatggtttacaagggaagcacagcaatccagcctac
ttggagaactctctctttactctaacaccattaacagcaggtagtgaaacagcctttggt
gtcacatttgattggaatgaggagtttggagttccaggtgcatttatcataaaaaatacg
catatcaatgagttctttctcaagtcactcacacttgaagatgtgcctaatcatggcaag
gtccattttgattgcaattcttgggtttatccttcttttagatacaagtcagatcgcatt
ttctttgcaaatcagccatatctcccaagtaaaacaccagagcttttgcgaaaatacaga
gaaaatgaattgctaacattaagaggagatggaactggaaagcgcgaggcgtgggatagg
atttatgactatgatatctacaatgacttgggtaatccggatcaaggtaaagaaaatgtt
agaactaccttaggaggttctgctgaatacccgtatcctcggagaggaagaactggtaga
ccaccaacacgaacagatcctaaaagtgaaagcaggattcctcttcttctgagcttagac
atctatgtaccgagagacgagcgttttggtcacttgaagatgtcagacttcctaacatat
gctttgaaatccattgttcaattcatcctccctgaattacatgccctgtttgatggtacc
cctaacgagttcgatagttttgaggatgtacttagactatatgaaggagggatcaaactt
cctcaaggacctttatttaaggctctcactgctgctatacctctggagatgataaaagaa
ctccttcgaacagacggtgaaggaatattgagatttccaactcctctagtgattaaagat
agtaaaaccgcgtggaggactgatgaagaattcgcaagagaaatgctagctggagttaat
cctatcataattagtagacttcaagaatttcctccaaaaagcaagctagatcccgaagca
tatggaaatcaaaacagtacaattactgcagaacacatagaggataagctggatggacta
acggttgatgaggcgatgaacaataataaacttttcatattgaaccatcatgatcttctt
ataccatatttgaggaggataaacactacaataacgaaatcatatgcctcgagaactttg
ctcttcttacaagataatggatctttgaagccactagcaattgaattgagtttgccacat
ccagatggagatcaatttggtgttactagcaaagtgtatactccaagtgatcaaggtgtt
gagagctctatctggcaattggccaaagcttatgttgcggtgaatgacgctggtgttcat
caactaattagtcattggttgaatactcatgcagtgatcgagccatttgtgattgcaaca
aacaggcaactaagtgtgcttcaccctattcataagcttctatatcctcatttccgggac
acaatgaatattaatgcttcggcaagacaaatcctaatcaatgctggtggagttcttgag
agtacagtttttcaatccaaatttgccctggaaatgtcagctgtcgtttacaaagattgg
gttttccctgatcaagcccttccagctgatcttgttaaaaggggagtagcagttgaggac
tcgagttctcctcatggtgttcgtttactgatagaggactatccatacgctgttgatggc
ttagaaatatggtctgcaatcaaaagttgggtgacagactactgcagcttctactatgga
tcggacgaagagattctgaaagacaatgaactccaagcctggtggaaggaactccgagaa
gtgggacatggtgacaagaaaaatgaaccatggtggcctgaaatggaaacaccacaagag
ctaatcgattcgtgtaccaccatcatatggatagcttctgcacttcatgcagcagttaat
tttgggcaatatccttatgcaggttacctcccaaatcgccccacagtaagtcgaagattc
atgcctgaaccaggaactcctgaatatgaagagctaaagaaaaaccccgataaggcattc
ttgaaaacaatcacagctcagttacaaacattgcttggtgtttccctcgtagagatattg
tcaaggcatactacagatgagatttacctcggacaacgagagtctcctgaatggacaaag
gacaaagaaccacttgctgctttcgacaaatttggaaagaagttgacagacattgaaaaa
cagattatacagaggaatggtgacaacatattgacaaacagatcaggccccgttaacgct
ccatatacattgcttttcccaacaagtgaaggtggacttacagggaaaggaattcccaac
agtgtgtcaatatag

DBGET integrated database retrieval system