KEGG   Solanum tuberosum (potato): 102577840Help
Entry
102577840         CDS       T02981                                 

Definition
(RefSeq) L-allo-threonine aldolase-related protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00260  Glycine, serine and threonine metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102577840
Enzymes [BR:sot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     102577840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 102577840
NCBI-ProteinID: NP_001275261
UniProt: Q2XPX1
Position
Un
AA seq 359 aa AA seqDB search
MVVRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFVP
SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLDL
IEAAIRDPSFEICYPTTRLICLENSQAHSGGRCLSAEYTDKVGELAKKYGLKLHIDGARI
FNASVALGVPVHRLVQAADSVSVCLSKGLGAPVGSVVVGSKSFIARAKILRKTLGGGMRQ
IGVLCAAAFTALQENLVKLEGDHRKAKSLAAELNKIKGLKVDVATVETNIVYCDILKGSR
ISETELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHYAVSCLQRALAGVAEENGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtggtaagaactgtggatcttcgctcagacacagtcactaaaccaactgaagccatg
cggaacgcaatggcgaatgctgaagtggatgatgatgtcttaggttatgatccaacagcc
caacgccttgaagcagagatggcaaggataacgggcaaagaagcaggattatttgttcct
tcaggcactatgggtaaccttatcagtgtgctgactcattgccaaatcaggggcagtgag
attattctcggtgattattcccatatccatatttatgaaaatggaggcatttccaccctt
ggaggtgttcatccaaggacagtgaagaacaatgaagatggtacaatggatcttgatctg
attgaagctgcgattcgagatcctagctttgaaatatgttacccaaccactaggctgata
tgcttggagaattcgcaagctcactcagggggcagatgcctttctgcggagtacacagac
aaagtcggagagctagcaaagaagtatggtctgaagcttcacattgatggagctcgtata
ttcaatgcatcagttgcacttggagtgcctgttcataggcttgtacaggctgctgattca
gtttcggtatgcttatcaaaaggtcttggtgctccagttggatctgttgttgttggttcg
aagagtttcattgccagggccaaaatcctgaggaagactctaggcggtgggatgaggcaa
attggtgtcctttgcgctgctgcttttaccgctttacaagagaatcttgttaagctggaa
ggagatcacagaaaggcaaagagtttggctgcggaacttaacaaaatcaaagggcttaaa
gttgatgttgctactgtagagactaacattgtatattgcgatatactgaaggggtcaagg
atcagcgaaacagaattggtcaagactttggaacagtatggtttacttatactaccagaa
ggcccactgagagtcagatttgttctacaccaccagatttcagaaagtgatgtacactat
gcagtgtcttgccttcagcgagctttagcaggagtggctgaagaaaatggtgacaagtaa

DBGET integrated database retrieval system