KEGG   Solanum tuberosum (potato): 102580208Help
Entry
102580208         CDS       T02981                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00562  Inositol phosphate metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102580208
   00562 Inositol phosphate metabolism
    102580208
Enzymes [BR:sot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102580208
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102580208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 102580208
NCBI-ProteinID: XP_006355645
UniProt: M1CL16
Position
Un
AA seq 501 aa AA seqDB search
MLNNSMNVALLLLIQLLLIAIAVQYSTADESFDVRQHLSTVSRYGIVKDISDDSFAPSQN
LDQCTPIHLNLVARHGTRAPTKKRIRELEAFAARLEVLVRDVKEQKQSLDKIPAWLMGWN
SPWKGKRTGGELISEGEDELYHLGIRVREQFPSLFSEEYHPAIYSIKTTQVPRASASAVA
FGMGLFSGKGKLGPGGYRAFAVTSESRASDTVLRFHDCCQSYKDFRKSQEPTVKKLKEPV
LDEITHELVKQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFSPAEVSLLEWADDLE
LFILKGYGNSLNYRMGVPLLEDVIQSMEQAIKAKEEGYAPGSYEKARLRFAHAETLLPFS
CLIGLFLEESEFELIQREQTLQYPPKPPKTRNWRGNMVAPFAGNNMLVLYSCVSDNSSKY
FVKVLHNERPIPIPGCNGSDSCPFEVFKERIAAPHLKHDYSALCNVNLEQKKDSAPGMFS
QMFGWIFSPRNADTPAQKVEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataactccatgaatgttgctctgttactactcattcaacttctactcattgca
attgcggtacagtactcaaccgctgatgaatccttcgatgttcgtcaacatctatcaact
gtatcgaggtatggtattgtgaaggatatatctgatgattcctttgctccttcccaaaat
ctcgatcagtgtacacctattcatttgaatcttgtggcgcggcatggcactcgtgctcct
acaaagaaaaggatcagggagctagaagcctttgctgctcgattggaagtccttgtacgt
gatgttaaggaacagaagcagtctttggataaaattcctgcttggttaatggggtggaac
tctccttggaagggcaaacgtacaggcggagagttgatcagcgaaggagaagacgagtta
tatcatcttggtatcagagtcagagaacagtttcccagcctgtttagtgaagaataccac
cctgctatatattcaatcaagactacccaggttcctcgggcatcagctagcgctgtggca
tttggcatgggtctgtttagtggaaaagggaagcttggaccaggaggttatcgagctttt
gctgttacaagtgaaagccgtgcaagtgatacagttttgagatttcatgattgttgtcaa
agctacaaggattttaggaaaagtcaggaaccaactgtaaagaagctcaaagaacctgta
ttagatgaaattactcatgaactagtgaagcaatacgggcttaattttacaaaacaggat
gtatcttctctatggtttttatgcaaacaggaagcttcactgttgaacatcaccaatcaa
gcttgcagtctattcagcccagcagaggtttctttgctggaatgggccgacgatttggag
ttattcatactaaagggctatggtaattcactaaattaccgaatgggagtgccgctactt
gaggatgtaattcaatccatggaacaggcaattaaggctaaagaagaaggatatgctccc
gggagctatgaaaaagcaagactacgttttgctcatgcagaaactctgcttcctttttca
tgcttgatcggactctttcttgaagaatctgaatttgaactaatacaaagagagcagaca
ttgcaataccctcctaagcctcctaaaacaagaaactggcggggaaatatggtggcacct
tttgctggaaataacatgctagtcctttacagctgtgtgtcagacaactcaagcaagtat
tttgttaaagtgctgcacaatgaacggcccattccaataccaggttgcaatggctcagat
tcttgcccatttgaagtatttaaggaaagaatagctgctcctcacttgaaacatgactac
agcgctctttgcaatgtgaatttggaacaaaaaaaggattctgcccccggtatgttctcg
caaatgtttggttggattttctcaccgaggaatgctgatacacccgcccagaaggttgag
ctataa

DBGET integrated database retrieval system